General information for g8110.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative NEDD8-conjugating enzyme UBE2F.
Parent gene
- The parent gene g8110 is located on chr_2: 28625010..28625672 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8110 | g8110.t1 | TTS | g8110.t1 | 28624976 | 28624976 |
| chr_2 | g8110 | g8110.t1 | isoform | g8110.t1 | 28625010 | 28625672 |
| chr_2 | g8110 | g8110.t1 | exon | g8110.t1.exon1 | 28625010 | 28625236 |
| chr_2 | g8110 | g8110.t1 | cds | g8110.t1.CDS1 | 28625010 | 28625236 |
| chr_2 | g8110 | g8110.t1 | exon | g8110.t1.exon2 | 28625302 | 28625537 |
| chr_2 | g8110 | g8110.t1 | cds | g8110.t1.CDS2 | 28625302 | 28625537 |
| chr_2 | g8110 | g8110.t1 | exon | g8110.t1.exon3 | 28625599 | 28625672 |
| chr_2 | g8110 | g8110.t1 | cds | g8110.t1.CDS3 | 28625599 | 28625672 |
| chr_2 | g8110 | g8110.t1 | TSS | g8110.t1 | 28625761 | 28625761 |
Sequences
>g8110.t1 Gene=g8110 Length=537
ATGATAACATTAACACGAAATATAAAAAAGTCGAATGATGTGAATGGTCAAAACAATAAA
CGCATCTCTATAAGAGATAAATTATTAGTAAAAGAGATTCAAGAAATGGAGTTATGCAAA
CCATCATCAGTGACATGTGAGTTTCCTGATTCAAATAATTTGAGTGAATTTTACATCATA
GTCACACCAGGAGATGAATCTTTATGGAGAAATGGAAGTTTCAAGTTTCTTGTAACTGTA
AATGAAGATTACAATATGATTCCACCAACAGTCAAGTGTTTAACAAAAGTTTTACATCCT
AATATTTCTTCTAATGGAGATGTATGCTTAAGTTTGTTGAGACTTAATTCTATAGATGGA
ACTAGCTGGTTACCAACTCGCCGCATGAAGGATGTCATGTTTGCACTGAATAGTCTTTTT
AGTGATTTGGTAGATTTTTCAGATCCATTAAACGTTGAATTAGCTGAAGAATACTCAAAA
GATAGTGAAAAGGCGAAAATGAAAATAAGAGAATATGTATTGAAACATGCTAGATAA
>g8110.t1 Gene=g8110 Length=178
MITLTRNIKKSNDVNGQNNKRISIRDKLLVKEIQEMELCKPSSVTCEFPDSNNLSEFYII
VTPGDESLWRNGSFKFLVTVNEDYNMIPPTVKCLTKVLHPNISSNGDVCLSLLRLNSIDG
TSWLPTRRMKDVMFALNSLFSDLVDFSDPLNVELAEEYSKDSEKAKMKIREYVLKHAR
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g8110.t1 | CDD | cd00195 | UBCc | 27 | 173 | 6.33826E-37 |
| 5 | g8110.t1 | Gene3D | G3DSA:3.10.110.10 | Ubiquitin Conjugating Enzyme | 12 | 178 | 1.4E-47 |
| 2 | g8110.t1 | PANTHER | PTHR24068:SF129 | NEDD8-CONJUGATING ENZYME UBE2F-RELATED | 15 | 173 | 8.3E-54 |
| 3 | g8110.t1 | PANTHER | PTHR24068 | UBIQUITIN-CONJUGATING ENZYME E2 | 15 | 173 | 8.3E-54 |
| 1 | g8110.t1 | Pfam | PF00179 | Ubiquitin-conjugating enzyme | 29 | 172 | 3.1E-29 |
| 7 | g8110.t1 | ProSitePatterns | PS00183 | Ubiquitin-conjugating enzymes active site. | 98 | 113 | - |
| 9 | g8110.t1 | ProSiteProfiles | PS50127 | Ubiquitin-conjugating enzymes family profile. | 27 | 167 | 24.153 |
| 8 | g8110.t1 | SMART | SM00212 | ubc_7 | 27 | 178 | 3.0E-37 |
| 4 | g8110.t1 | SUPERFAMILY | SSF54495 | UBC-like | 7 | 177 | 2.12E-39 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K10687 (ubiquitin-conjugating enzyme E2 F)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
