General information for g8110.t6
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative NEDD8-conjugating enzyme UBE2F.
Parent gene
- The parent gene g8110 is located on chr_2: 28625010..28625672 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8110 | g8110.t6 | TTS | g8110.t6 | 28624976 | 28624976 |
| chr_2 | g8110 | g8110.t6 | isoform | g8110.t6 | 28625010 | 28625539 |
| chr_2 | g8110 | g8110.t6 | exon | g8110.t6.exon1 | 28625010 | 28625236 |
| chr_2 | g8110 | g8110.t6 | cds | g8110.t6.CDS1 | 28625010 | 28625236 |
| chr_2 | g8110 | g8110.t6 | exon | g8110.t6.exon2 | 28625302 | 28625539 |
| chr_2 | g8110 | g8110.t6 | cds | g8110.t6.CDS2 | 28625302 | 28625506 |
| chr_2 | g8110 | g8110.t6 | TSS | g8110.t6 | 28625761 | 28625761 |
Sequences
>g8110.t6 Gene=g8110 Length=465
AGAGATAAATTATTAGTAAAAGAGATTCAAGAAATGGAGTTATGCAAACCATCATCAGTG
ACATGTGAGTTTCCTGATTCAAATAATTTGAGTGAATTTTACATCATAGTCACACCAGGA
GATGAATCTTTATGGAGAAATGGAAGTTTCAAGTTTCTTGTAACTGTAAATGAAGATTAC
AATATGATTCCACCAACAGTCAAGTGTTTAACAAAAGTTTTACATCCTAATATTTCTTCT
AATGGAGATGTATGCTTAAGTTTGTTGAGACTTAATTCTATAGATGGAACTAGCTGGTTA
CCAACTCGCCGCATGAAGGATGTCATGTTTGCACTGAATAGTCTTTTTAGTGATTTGGTA
GATTTTTCAGATCCATTAAACGTTGAATTAGCTGAAGAATACTCAAAAGATAGTGAAAAG
GCGAAAATGAAAATAAGAGAATATGTATTGAAACATGCTAGATAA
>g8110.t6 Gene=g8110 Length=143
MELCKPSSVTCEFPDSNNLSEFYIIVTPGDESLWRNGSFKFLVTVNEDYNMIPPTVKCLT
KVLHPNISSNGDVCLSLLRLNSIDGTSWLPTRRMKDVMFALNSLFSDLVDFSDPLNVELA
EEYSKDSEKAKMKIREYVLKHAR
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g8110.t6 | CDD | cd00195 | UBCc | 1 | 138 | 4.42749E-33 |
| 5 | g8110.t6 | Gene3D | G3DSA:3.10.110.10 | Ubiquitin Conjugating Enzyme | 1 | 143 | 2.5E-42 |
| 2 | g8110.t6 | PANTHER | PTHR24068:SF129 | NEDD8-CONJUGATING ENZYME UBE2F-RELATED | 6 | 138 | 3.6E-45 |
| 3 | g8110.t6 | PANTHER | PTHR24068 | UBIQUITIN-CONJUGATING ENZYME E2 | 6 | 138 | 3.6E-45 |
| 1 | g8110.t6 | Pfam | PF00179 | Ubiquitin-conjugating enzyme | 5 | 137 | 8.4E-28 |
| 7 | g8110.t6 | ProSitePatterns | PS00183 | Ubiquitin-conjugating enzymes active site. | 63 | 78 | - |
| 9 | g8110.t6 | ProSiteProfiles | PS50127 | Ubiquitin-conjugating enzymes family profile. | 1 | 132 | 22.154 |
| 8 | g8110.t6 | SMART | SM00212 | ubc_7 | 1 | 143 | 1.2E-29 |
| 4 | g8110.t6 | SUPERFAMILY | SSF54495 | UBC-like | 5 | 142 | 5.37E-35 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
