Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative Probable cytochrome P450 4d14.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g8132 g8132.t8 TSS g8132.t8 28721717 28721717
chr_2 g8132 g8132.t8 isoform g8132.t8 28721877 28722381
chr_2 g8132 g8132.t8 exon g8132.t8.exon1 28721877 28721978
chr_2 g8132 g8132.t8 cds g8132.t8.CDS1 28721969 28721978
chr_2 g8132 g8132.t8 exon g8132.t8.exon2 28722032 28722381
chr_2 g8132 g8132.t8 cds g8132.t8.CDS2 28722032 28722381
chr_2 g8132 g8132.t8 TTS g8132.t8 28722495 28722495

Sequences

>g8132.t8 Gene=g8132 Length=452
TTAATGAGTTGAAATATTTAGAACTTGTCTGCAAAGAATCATTGAGATTATATCCATCTG
TTCCAATTTTTGGTCGAAGAACAGTTGAAGAAATGATGATAAATGATAAAATGATACCAA
AAGATACAACTCTTCTAATGCTGCCTTACTTTATGGCAAGAGATCCAGAAATTTGGCAAA
ATCCTGAAAAATTTATTCCTGAAAGACACGCTGTTGAAAAGGATAACGAAGATTCGCAAG
TTTTTACATACATTCCTTTCTCGGGTGGTTACCGAAATTGTATTGGACAAAAATTCGCTA
TGTTAGAACTTAAATCGACCGTCTCAAAAGTAGTATTGAATTACAAATTAAGTGTAAAAG
AAAATTTCACTCCTGAAGACGCTCTTGAACTTGTCATAAAAAGTACTAATGGAATAATGC
TCAAAATTGAAAGTAGAAAATTAAGCAATTAA

>g8132.t8 Gene=g8132 Length=119
MMINDKMIPKDTTLLMLPYFMARDPEIWQNPEKFIPERHAVEKDNEDSQVFTYIPFSGGY
RNCIGQKFAMLELKSTVSKVVLNYKLSVKENFTPEDALELVIKSTNGIMLKIESRKLSN

Protein features from InterProScan

Transcript Database ID Name Start End E.value
10 g8132.t8 Gene3D G3DSA:1.10.630.10 Cytochrome p450 1 119 2.3E-32
2 g8132.t8 PANTHER PTHR24291:SF143 CYTOCHROME P450 4D1-RELATED 3 115 1.2E-28
3 g8132.t8 PANTHER PTHR24291 CYTOCHROME P450 FAMILY 4 3 115 1.2E-28
5 g8132.t8 PRINTS PR00465 E-class P450 group IV signature 6 20 2.9E-11
7 g8132.t8 PRINTS PR00465 E-class P450 group IV signature 22 40 2.9E-11
4 g8132.t8 PRINTS PR00465 E-class P450 group IV signature 47 63 2.9E-11
6 g8132.t8 PRINTS PR00465 E-class P450 group IV signature 63 81 2.9E-11
1 g8132.t8 Pfam PF00067 Cytochrome P450 2 111 1.0E-29
9 g8132.t8 ProSitePatterns PS00086 Cytochrome P450 cysteine heme-iron ligand signature. 56 65 -
8 g8132.t8 SUPERFAMILY SSF48264 Cytochrome P450 2 115 1.23E-30

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0020037 heme binding MF
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen MF
GO:0005506 iron ion binding MF
GO:0004497 monooxygenase activity MF
GO:0055114 NA NA

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values