General information for g8175.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g8175 is located on chr_2: 28919456..28919748 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8175 | g8175.t1 | TSS | g8175.t1 | 28919417 | 28919417 |
| chr_2 | g8175 | g8175.t1 | isoform | g8175.t1 | 28919456 | 28919748 |
| chr_2 | g8175 | g8175.t1 | exon | g8175.t1.exon1 | 28919456 | 28919596 |
| chr_2 | g8175 | g8175.t1 | cds | g8175.t1.CDS1 | 28919456 | 28919596 |
| chr_2 | g8175 | g8175.t1 | exon | g8175.t1.exon2 | 28919656 | 28919748 |
| chr_2 | g8175 | g8175.t1 | cds | g8175.t1.CDS2 | 28919656 | 28919748 |
| chr_2 | g8175 | g8175.t1 | TTS | g8175.t1 | 28919906 | 28919906 |
Sequences
>g8175.t1 Gene=g8175 Length=234
ATGGTTTTTGCAAAAACATGGGAAGATTTTGAAATTGCTGCTGAATCAATGTTAATGGAA
CATCCTGAAAAGTGCAGATATAGTATGAAATATACACATAATCAACAAAAATTAGTTTTG
AAAGTTACAAACAATCAAAAGTGCATACAGTATAAAACAGAAATTCAGCCTGATCTAAAG
AAAATAGAAAAGTTTACAGGCAATGTAATGAATCAATTAACATCAAAAAATTAA
>g8175.t1 Gene=g8175 Length=77
MVFAKTWEDFEIAAESMLMEHPEKCRYSMKYTHNQQKLVLKVTNNQKCIQYKTEIQPDLK
KIEKFTGNVMNQLTSKN
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 5 | g8175.t1 | Gene3D | G3DSA:3.30.720.10 | Signal recognition particle alu RNA binding heterodimer | 3 | 77 | 0 |
| 2 | g8175.t1 | PANTHER | PTHR12834:SF12 | SIGNAL RECOGNITION PARTICLE 9 KDA PROTEIN | 1 | 75 | 0 |
| 3 | g8175.t1 | PANTHER | PTHR12834 | SIGNAL RECOGNITION PARTICLE 9 KDA PROTEIN | 1 | 75 | 0 |
| 6 | g8175.t1 | PIRSF | PIRSF017029 | SRP9 | 1 | 77 | 0 |
| 1 | g8175.t1 | Pfam | PF05486 | Signal recognition particle 9 kDa protein (SRP9) | 5 | 72 | 0 |
| 4 | g8175.t1 | SUPERFAMILY | SSF54762 | Signal recognition particle alu RNA binding heterodimer, SRP9/14 | 5 | 77 | 0 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006614 | SRP-dependent cotranslational protein targeting to membrane | BP |
| GO:0045900 | negative regulation of translational elongation | BP |
| GO:0048500 | signal recognition particle | CC |
| GO:0008312 | 7S RNA binding | MF |
KEGG
Orthology
- This transcript has been annotated with K03109 (signal recognition particle subunit SRP9)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
