| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8185 | g8185.t58 | TTS | g8185.t58 | 28961757 | 28961757 |
| chr_2 | g8185 | g8185.t58 | isoform | g8185.t58 | 28962527 | 28963602 |
| chr_2 | g8185 | g8185.t58 | exon | g8185.t58.exon1 | 28962527 | 28962702 |
| chr_2 | g8185 | g8185.t58 | cds | g8185.t58.CDS1 | 28962528 | 28962702 |
| chr_2 | g8185 | g8185.t58 | exon | g8185.t58.exon2 | 28962756 | 28962952 |
| chr_2 | g8185 | g8185.t58 | cds | g8185.t58.CDS2 | 28962756 | 28962952 |
| chr_2 | g8185 | g8185.t58 | exon | g8185.t58.exon3 | 28963537 | 28963602 |
| chr_2 | g8185 | g8185.t58 | cds | g8185.t58.CDS3 | 28963537 | 28963602 |
| chr_2 | g8185 | g8185.t58 | TSS | g8185.t58 | 28963786 | 28963786 |
>g8185.t58 Gene=g8185 Length=439
ATGGGTTTAACTTGTGGAGCATCTGTGGTCAAATATGGCATTTTTATTTTCAACCTTCTT
TGTGCTGTTGCTGGTATAGCATTGATCGTTGTTGGTGCAATTCCACTATTCAAACTTGAT
GACATTCGAGATGCCTTTCCTGAAAACAATCCAGCCACTGTTCCCATCATAATCGTCGTT
CTTGGCTCGATAATCTTTATCATCAGTTTCTTTGGATGTTGTGGAGCTATTAGAGAAAAT
CAGTGTATGGTTTCAACGGTACGTACGCATTTTTCCTACTCATATTGGTCGTTCTTCAAA
TTGTTATCGCCGTTTTCGCATTTATGTATACAGGTGAACTTGCGAAAGCTGCAGAAAATG
GTTTCAATAAATTATGGGAAAACAGAGACACAAATAATGAAACAAGAATTGCTATCGAAG
GCATACAACGCGGACTTCG
>g8185.t58 Gene=g8185 Length=146
MGLTCGASVVKYGIFIFNLLCAVAGIALIVVGAIPLFKLDDIRDAFPENNPATVPIIIVV
LGSIIFIISFFGCCGAIRENQCMVSTVRTHFSYSYWSFFKLLSPFSHLCIQVNLRKLQKM
VSINYGKTETQIMKQELLSKAYNADF
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g8185.t58 | PANTHER | PTHR19282 | TETRASPANIN | 6 | 86 | 6.8E-16 |
| 3 | g8185.t58 | PANTHER | PTHR19282:SF471 | CD63 ANTIGEN | 6 | 86 | 6.8E-16 |
| 5 | g8185.t58 | PRINTS | PR00259 | Transmembrane four family signature | 12 | 35 | 1.0E-10 |
| 4 | g8185.t58 | PRINTS | PR00259 | Transmembrane four family signature | 51 | 77 | 1.0E-10 |
| 1 | g8185.t58 | Pfam | PF00335 | Tetraspanin family | 10 | 86 | 1.1E-17 |
| 9 | g8185.t58 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 11 | - |
| 13 | g8185.t58 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 34 | - |
| 11 | g8185.t58 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 35 | 53 | - |
| 12 | g8185.t58 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 54 | 77 | - |
| 10 | g8185.t58 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 78 | 146 | - |
| 8 | g8185.t58 | ProSitePatterns | PS00421 | Transmembrane 4 family signature. | 62 | 84 | - |
| 7 | g8185.t58 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 34 | - |
| 6 | g8185.t58 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 54 | 76 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016021 | integral component of membrane | CC |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed