Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g8185 g8185.t59 TTS g8185.t59 28961757 28961757
chr_2 g8185 g8185.t59 isoform g8185.t59 28962574 28963602
chr_2 g8185 g8185.t59 exon g8185.t59.exon1 28962574 28962702
chr_2 g8185 g8185.t59 cds g8185.t59.CDS1 28962574 28962702
chr_2 g8185 g8185.t59 exon g8185.t59.exon2 28962761 28962939
chr_2 g8185 g8185.t59 cds g8185.t59.CDS2 28962761 28962939
chr_2 g8185 g8185.t59 exon g8185.t59.exon3 28963542 28963602
chr_2 g8185 g8185.t59 cds g8185.t59.CDS3 28963542 28963602
chr_2 g8185 g8185.t59 TSS g8185.t59 28963786 28963786

Sequences

>g8185.t59 Gene=g8185 Length=369
ATGGGTTTAACTTGTGGAGCATCTGTGGTCAAATATGGCATTTTTATTTTCAACCTTCTT
TCATTGATCGTTGTTGGTGCAATTCCACTATTCAAACTTGATGACATTCGAGATGCCTTT
CCTGAAAACAATCCAGCCACTGTTCCCATCATAATCGTCGTTCTTGGCTCGATAATCTTT
ATCATCAGTTTCTTTGGATGTTGTGGAGCTATTAGAGAAAATCAGTGTATGGTTTCAACG
TACGCATTTTTCCTACTCATATTGGTCGTTCTTCAAATTGTTATCGCCGTTTTCGCATTT
ATGTATACAGGTGAACTTGCGAAAGCTGCAGAAAATGGTTTCAATAAATTATGGGAAAAC
AGAGACACA

>g8185.t59 Gene=g8185 Length=123
MGLTCGASVVKYGIFIFNLLSLIVVGAIPLFKLDDIRDAFPENNPATVPIIIVVLGSIIF
IISFFGCCGAIRENQCMVSTYAFFLLILVVLQIVIAVFAFMYTGELAKAAENGFNKLWEN
RDT

Protein features from InterProScan

Transcript Database ID Name Start End E.value
2 g8185.t59 PANTHER PTHR19282:SF394 GH14950P-RELATED 10 118 4.3E-18
3 g8185.t59 PANTHER PTHR19282 TETRASPANIN 10 118 4.3E-18
4 g8185.t59 PRINTS PR00259 Transmembrane four family signature 45 71 3.7E-18
5 g8185.t59 PRINTS PR00259 Transmembrane four family signature 72 100 3.7E-18
1 g8185.t59 Pfam PF00335 Tetraspanin family 10 120 1.8E-23
11 g8185.t59 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 1 11 -
15 g8185.t59 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 12 30 -
12 g8185.t59 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 31 49 -
16 g8185.t59 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 50 71 -
10 g8185.t59 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 72 82 -
14 g8185.t59 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 83 102 -
13 g8185.t59 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 103 123 -
9 g8185.t59 ProSitePatterns PS00421 Transmembrane 4 family signature. 56 78 -
8 g8185.t59 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 12 31 -
7 g8185.t59 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 46 68 -
6 g8185.t59 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 81 103 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0016021 integral component of membrane CC

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values