| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8185 | g8185.t59 | TTS | g8185.t59 | 28961757 | 28961757 |
| chr_2 | g8185 | g8185.t59 | isoform | g8185.t59 | 28962574 | 28963602 |
| chr_2 | g8185 | g8185.t59 | exon | g8185.t59.exon1 | 28962574 | 28962702 |
| chr_2 | g8185 | g8185.t59 | cds | g8185.t59.CDS1 | 28962574 | 28962702 |
| chr_2 | g8185 | g8185.t59 | exon | g8185.t59.exon2 | 28962761 | 28962939 |
| chr_2 | g8185 | g8185.t59 | cds | g8185.t59.CDS2 | 28962761 | 28962939 |
| chr_2 | g8185 | g8185.t59 | exon | g8185.t59.exon3 | 28963542 | 28963602 |
| chr_2 | g8185 | g8185.t59 | cds | g8185.t59.CDS3 | 28963542 | 28963602 |
| chr_2 | g8185 | g8185.t59 | TSS | g8185.t59 | 28963786 | 28963786 |
>g8185.t59 Gene=g8185 Length=369
ATGGGTTTAACTTGTGGAGCATCTGTGGTCAAATATGGCATTTTTATTTTCAACCTTCTT
TCATTGATCGTTGTTGGTGCAATTCCACTATTCAAACTTGATGACATTCGAGATGCCTTT
CCTGAAAACAATCCAGCCACTGTTCCCATCATAATCGTCGTTCTTGGCTCGATAATCTTT
ATCATCAGTTTCTTTGGATGTTGTGGAGCTATTAGAGAAAATCAGTGTATGGTTTCAACG
TACGCATTTTTCCTACTCATATTGGTCGTTCTTCAAATTGTTATCGCCGTTTTCGCATTT
ATGTATACAGGTGAACTTGCGAAAGCTGCAGAAAATGGTTTCAATAAATTATGGGAAAAC
AGAGACACA
>g8185.t59 Gene=g8185 Length=123
MGLTCGASVVKYGIFIFNLLSLIVVGAIPLFKLDDIRDAFPENNPATVPIIIVVLGSIIF
IISFFGCCGAIRENQCMVSTYAFFLLILVVLQIVIAVFAFMYTGELAKAAENGFNKLWEN
RDT
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g8185.t59 | PANTHER | PTHR19282:SF394 | GH14950P-RELATED | 10 | 118 | 4.3E-18 |
| 3 | g8185.t59 | PANTHER | PTHR19282 | TETRASPANIN | 10 | 118 | 4.3E-18 |
| 4 | g8185.t59 | PRINTS | PR00259 | Transmembrane four family signature | 45 | 71 | 3.7E-18 |
| 5 | g8185.t59 | PRINTS | PR00259 | Transmembrane four family signature | 72 | 100 | 3.7E-18 |
| 1 | g8185.t59 | Pfam | PF00335 | Tetraspanin family | 10 | 120 | 1.8E-23 |
| 11 | g8185.t59 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 11 | - |
| 15 | g8185.t59 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 30 | - |
| 12 | g8185.t59 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 31 | 49 | - |
| 16 | g8185.t59 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 50 | 71 | - |
| 10 | g8185.t59 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 72 | 82 | - |
| 14 | g8185.t59 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 83 | 102 | - |
| 13 | g8185.t59 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 103 | 123 | - |
| 9 | g8185.t59 | ProSitePatterns | PS00421 | Transmembrane 4 family signature. | 56 | 78 | - |
| 8 | g8185.t59 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 31 | - |
| 7 | g8185.t59 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 46 | 68 | - |
| 6 | g8185.t59 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 81 | 103 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016021 | integral component of membrane | CC |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.