General information for g8205.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Translocator protein.
Parent gene
- The parent gene g8205 is located on chr_2: 29059583..29060102 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8205 | g8205.t1 | isoform | g8205.t1 | 29058764 | 29060102 |
| chr_2 | g8205 | g8205.t1 | exon | g8205.t1.exon1 | 29058764 | 29059090 |
| chr_2 | g8205 | g8205.t1 | cds | g8205.t1.CDS1 | 29058764 | 29059090 |
| chr_2 | g8205 | g8205.t1 | exon | g8205.t1.exon2 | 29059148 | 29059282 |
| chr_2 | g8205 | g8205.t1 | cds | g8205.t1.CDS2 | 29059148 | 29059282 |
| chr_2 | g8205 | g8205.t1 | exon | g8205.t1.exon3 | 29059583 | 29059814 |
| chr_2 | g8205 | g8205.t1 | cds | g8205.t1.CDS3 | 29059583 | 29059814 |
| chr_2 | g8205 | g8205.t1 | exon | g8205.t1.exon4 | 29059897 | 29060102 |
| chr_2 | g8205 | g8205.t1 | cds | g8205.t1.CDS4 | 29059897 | 29060102 |
| chr_2 | g8205 | g8205.t1 | TSS | g8205.t1 | 29060141 | 29060141 |
| chr_2 | g8205 | g8205.t1 | TTS | g8205.t1 | NA | NA |
Sequences
>g8205.t1 Gene=g8205 Length=900
ATGAGTATTTTAAAGAATAAAATTGTCCAAATTATTATTGCGTGCTTGATTCCTTTGGTT
GGAGGATTGATTGTATCGATGACAACAATGGGAAATAAAGAACCTTGGTATTCAACAATA
AATAAGCCTTCATGGAATCCCAAAGATTGGATTTTTGCACCAGTTTGGTCTTTTCTTTAT
ATTTCAATGGGCTATGCAAGTTTTAGAGTTTATGATGAAGGTGAAGGTTTTAAAGGACAA
GCACGCTTTCCGATTATTATGTACATTATTCAATTAATTGTTAATCTAACGTGGACTCCG
GTTTTCTTTTATTATCATTTAATTGGTGCTGCAACAATTCACATTTTTGCTGTATTAGTG
ACACTAATCATCACTGGAATTCTTTTCTATAGAATTGATAAAACAGCTGGGATTTTATTC
ATACCTTATTTTGCATGGCACAAATATTTTCAAATTATTATTAGTATCCTCATTCCTTTA
ATATTGGGATTTGTTACATCAATAGTTGCATTGTCCCGAAAAGAGCCATTTTATTTTGAT
CTTGAAAAGCCCAAATATACGCCACCGGATTGGATATTTCCTTTTGTATGGATCTTTATA
TATGTAAGCATTGGTTATGCTAGCTTCCGAGTATATGATAAATCGGCAAAATCAGCAAAA
ATTGCTTTGATCATCTACATCATTCAATTATTCTTCAATATTACATGGACAGCTACATTC
TTTTTCTTTCATGTCACTGGTTTCGCGATTTTCCATATTATCATAGTATTTTTTTTATTG
GTCACCACTGGACTTCTCTTTTACAGAGTTGATAAAGTCGCAGGACTTCTTTTTATTCCA
TATGGTATTTGGGTCACATATGCTGCATGCGTTTTGGTCGCAATTTTCAAAATGAATTAA
>g8205.t1 Gene=g8205 Length=299
MSILKNKIVQIIIACLIPLVGGLIVSMTTMGNKEPWYSTINKPSWNPKDWIFAPVWSFLY
ISMGYASFRVYDEGEGFKGQARFPIIMYIIQLIVNLTWTPVFFYYHLIGAATIHIFAVLV
TLIITGILFYRIDKTAGILFIPYFAWHKYFQIIISILIPLILGFVTSIVALSRKEPFYFD
LEKPKYTPPDWIFPFVWIFIYVSIGYASFRVYDKSAKSAKIALIIYIIQLFFNITWTATF
FFFHVTGFAIFHIIIVFFLLVTTGLLFYRVDKVAGLLFIPYGIWVTYAACVLVAIFKMN
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 35 | g8205.t1 | CDD | cd15904 | TSPO_MBR | 16 | 146 | 9.39025E-41 |
| 36 | g8205.t1 | CDD | cd15904 | TSPO_MBR | 163 | 296 | 5.69972E-32 |
| 14 | g8205.t1 | Gene3D | G3DSA:1.20.1260.100 | - | 4 | 150 | 4.7E-48 |
| 15 | g8205.t1 | Gene3D | G3DSA:1.20.1260.100 | - | 151 | 299 | 6.0E-39 |
| 3 | g8205.t1 | PANTHER | PTHR10057 | PERIPHERAL-TYPE BENZODIAZEPINE RECEPTOR | 7 | 150 | 5.6E-81 |
| 4 | g8205.t1 | PANTHER | PTHR10057 | PERIPHERAL-TYPE BENZODIAZEPINE RECEPTOR | 151 | 299 | 5.6E-81 |
| 1 | g8205.t1 | Pfam | PF03073 | TspO/MBR family | 14 | 149 | 2.6E-39 |
| 2 | g8205.t1 | Pfam | PF03073 | TspO/MBR family | 155 | 295 | 3.4E-33 |
| 17 | g8205.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 11 | - |
| 29 | g8205.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 30 | - |
| 24 | g8205.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 31 | 49 | - |
| 31 | g8205.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 50 | 71 | - |
| 16 | g8205.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 72 | 82 | - |
| 34 | g8205.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 83 | 105 | - |
| 23 | g8205.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 106 | 110 | - |
| 30 | g8205.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 111 | 130 | - |
| 18 | g8205.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 131 | 149 | - |
| 33 | g8205.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 150 | 171 | - |
| 21 | g8205.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 172 | 190 | - |
| 32 | g8205.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 191 | 209 | - |
| 20 | g8205.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 210 | 220 | - |
| 27 | g8205.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 221 | 243 | - |
| 22 | g8205.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 244 | 248 | - |
| 28 | g8205.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 249 | 268 | - |
| 19 | g8205.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 269 | 274 | - |
| 26 | g8205.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 275 | 296 | - |
| 25 | g8205.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 297 | 299 | - |
| 12 | g8205.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 9 | 31 | - |
| 13 | g8205.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 51 | 68 | - |
| 6 | g8205.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 81 | 103 | - |
| 8 | g8205.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 107 | 129 | - |
| 9 | g8205.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 149 | 171 | - |
| 10 | g8205.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 191 | 209 | - |
| 5 | g8205.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 221 | 243 | - |
| 11 | g8205.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 248 | 267 | - |
| 7 | g8205.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 274 | 296 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016021 | integral component of membrane | CC |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
