| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8205 | g8205.t4 | TTS | g8205.t4 | 29059482 | 29059482 |
| chr_2 | g8205 | g8205.t4 | isoform | g8205.t4 | 29059583 | 29060102 |
| chr_2 | g8205 | g8205.t4 | exon | g8205.t4.exon1 | 29059583 | 29059814 |
| chr_2 | g8205 | g8205.t4 | cds | g8205.t4.CDS1 | 29059583 | 29059814 |
| chr_2 | g8205 | g8205.t4 | exon | g8205.t4.exon2 | 29059897 | 29060102 |
| chr_2 | g8205 | g8205.t4 | cds | g8205.t4.CDS2 | 29059897 | 29060102 |
| chr_2 | g8205 | g8205.t4 | TSS | g8205.t4 | 29060141 | 29060141 |
>g8205.t4 Gene=g8205 Length=438
ATGAGTATTTTAAAGAATAAAATTGTCCAAATTATTATTGCGTGCTTGATTCCTTTGGTT
GGAGGATTGATTGTATCGATGACAACAATGGGAAATAAAGAACCTTGGTATTCAACAATA
AATAAGCCTTCATGGAATCCCAAAGATTGGATTTTTGCACCAGTTTGGTCTTTTCTTTAT
ATTTCAATGGGCTATGCAAGTTTTAGAGTTTATGATGAAGGTGAAGGTTTTAAAGGACAA
GCACGCTTTCCGATTATTATGTACATTATTCAATTAATTGTTAATCTAACGTGGACTCCG
GTTTTCTTTTATTATCATTTAATTGGTGCTGCAACAATTCACATTTTTGCTGTATTAGTG
ACACTAATCATCACTGGAATTCTTTTCTATAGAATTGATAAAACAGCTGGGATTTTATTC
ATACCTTATTTTGCATGG
>g8205.t4 Gene=g8205 Length=146
MSILKNKIVQIIIACLIPLVGGLIVSMTTMGNKEPWYSTINKPSWNPKDWIFAPVWSFLY
ISMGYASFRVYDEGEGFKGQARFPIIMYIIQLIVNLTWTPVFFYYHLIGAATIHIFAVLV
TLIITGILFYRIDKTAGILFIPYFAW
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 18 | g8205.t4 | CDD | cd15904 | TSPO_MBR | 16 | 146 | 7.19974E-44 |
| 7 | g8205.t4 | Gene3D | G3DSA:1.20.1260.100 | - | 4 | 146 | 1.3E-48 |
| 2 | g8205.t4 | PANTHER | PTHR10057 | PERIPHERAL-TYPE BENZODIAZEPINE RECEPTOR | 7 | 146 | 2.2E-42 |
| 17 | g8205.t4 | PIRSF | PIRSF005859 | PBR | 1 | 146 | 6.7E-41 |
| 1 | g8205.t4 | Pfam | PF03073 | TspO/MBR family | 14 | 146 | 1.2E-39 |
| 9 | g8205.t4 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 11 | - |
| 13 | g8205.t4 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 30 | - |
| 12 | g8205.t4 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 31 | 49 | - |
| 16 | g8205.t4 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 50 | 71 | - |
| 8 | g8205.t4 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 72 | 82 | - |
| 15 | g8205.t4 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 83 | 105 | - |
| 11 | g8205.t4 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 106 | 110 | - |
| 14 | g8205.t4 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 111 | 130 | - |
| 10 | g8205.t4 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 131 | 146 | - |
| 4 | g8205.t4 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 7 | 29 | - |
| 3 | g8205.t4 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 49 | 71 | - |
| 6 | g8205.t4 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 83 | 105 | - |
| 5 | g8205.t4 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 110 | 132 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016021 | integral component of membrane | CC |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.