General information for g8215.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g8215 is located on chr_2: 29092690..29093173 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8215 | g8215.t1 | isoform | g8215.t1 | 29092690 | 29093173 |
| chr_2 | g8215 | g8215.t1 | exon | g8215.t1.exon1 | 29092690 | 29092781 |
| chr_2 | g8215 | g8215.t1 | cds | g8215.t1.CDS1 | 29092690 | 29092781 |
| chr_2 | g8215 | g8215.t1 | exon | g8215.t1.exon2 | 29092845 | 29092907 |
| chr_2 | g8215 | g8215.t1 | cds | g8215.t1.CDS2 | 29092845 | 29092907 |
| chr_2 | g8215 | g8215.t1 | exon | g8215.t1.exon3 | 29092968 | 29093039 |
| chr_2 | g8215 | g8215.t1 | cds | g8215.t1.CDS3 | 29092968 | 29093039 |
| chr_2 | g8215 | g8215.t1 | exon | g8215.t1.exon4 | 29093122 | 29093173 |
| chr_2 | g8215 | g8215.t1 | cds | g8215.t1.CDS4 | 29093122 | 29093173 |
| chr_2 | g8215 | g8215.t1 | TSS | g8215.t1 | 29093433 | 29093433 |
| chr_2 | g8215 | g8215.t1 | TTS | g8215.t1 | NA | NA |
Sequences
>g8215.t1 Gene=g8215 Length=279
ATGAGGACCGTGAGTCAAAATTCGGCTAATGTATTTGCCGTTTCAGGACCTGTCGTCACT
GCTGAACGAATGGCTGGATCAGCTATGTACGAGTTGGTGCGTGTAGGCTATTATGAATTG
GTTGGTGTAACTGTTGGTGATCCTGTCTTGAGAACTGGCAAACCTTTATCAGTCGAATTG
GGTCCAGGTATTATGGGTAGTATTTTTGACGGTATTCAACGTCCATTAAAAGACATTAAT
GAATTGACACAATCAATTTTATATCCCAAAGGGAATTAA
>g8215.t1 Gene=g8215 Length=92
MRTVSQNSANVFAVSGPVVTAERMAGSAMYELVRVGYYELVGVTVGDPVLRTGKPLSVEL
GPGIMGSIFDGIQRPLKDINELTQSILYPKGN
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 4 | g8215.t1 | Gene3D | G3DSA:2.40.30.20 | - | 2 | 44 | 0 |
| 3 | g8215.t1 | Gene3D | G3DSA:3.40.50.300 | - | 46 | 90 | 0 |
| 1 | g8215.t1 | PANTHER | PTHR43607:SF1 | V-TYPE PROTON ATPASE CATALYTIC SUBUNIT A | 6 | 91 | 0 |
| 2 | g8215.t1 | PANTHER | PTHR43607 | V-TYPE PROTON ATPASE CATALYTIC SUBUNIT A | 6 | 91 | 0 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0046034 | ATP metabolic process | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed