General information for g8235.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Ubiquitin-conjugating enzyme E2 variant 2.
Parent gene
- The parent gene g8235 is located on chr_2: 29211433..29212531 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8235 | g8235.t1 | TTS | g8235.t1 | 29211315 | 29211315 |
| chr_2 | g8235 | g8235.t1 | isoform | g8235.t1 | 29211433 | 29212531 |
| chr_2 | g8235 | g8235.t1 | exon | g8235.t1.exon1 | 29211433 | 29211573 |
| chr_2 | g8235 | g8235.t1 | cds | g8235.t1.CDS1 | 29211433 | 29211573 |
| chr_2 | g8235 | g8235.t1 | exon | g8235.t1.exon2 | 29211638 | 29211763 |
| chr_2 | g8235 | g8235.t1 | cds | g8235.t1.CDS2 | 29211638 | 29211763 |
| chr_2 | g8235 | g8235.t1 | exon | g8235.t1.exon3 | 29211970 | 29212112 |
| chr_2 | g8235 | g8235.t1 | cds | g8235.t1.CDS3 | 29211970 | 29212112 |
| chr_2 | g8235 | g8235.t1 | exon | g8235.t1.exon4 | 29212516 | 29212531 |
| chr_2 | g8235 | g8235.t1 | cds | g8235.t1.CDS4 | 29212516 | 29212531 |
| chr_2 | g8235 | g8235.t1 | TSS | g8235.t1 | 29212710 | 29212710 |
Sequences
>g8235.t1 Gene=g8235 Length=426
ATGTCGTCGGGTGTCGTGGTTCCACGAAATTTTCGCTTGCTTGAAGAATTGGAAGCTGGT
CAAAAAGGAGTTGGTGACGGTACAATTTCATGGGGACTAGAAAATGATGATGATATGACT
TTGACTCACTGGACTGGAATGATAATTGGGCCACCAAGAACTCCATACGAGAATAGAATA
TATTCATTAAAAATAGAATGCGGTAATCGTTATCCTGATGAGCCACCAACATTGAAATTT
CTAACAAAAATCAATATAAATTGTATAAACAGTCAGTCTGGTGTGGTTGATCATAGATTA
GTTCCAATCTTGGCACGATGGACCCGTGATTATACAATCAAATCAACACTGCAAGAAATT
CGTAGAATTATGACGCTTAAAGATAATTTAAAGCTCACGCAACCGCCAGAAGGATCATGC
TTTTAA
>g8235.t1 Gene=g8235 Length=141
MSSGVVVPRNFRLLEELEAGQKGVGDGTISWGLENDDDMTLTHWTGMIIGPPRTPYENRI
YSLKIECGNRYPDEPPTLKFLTKININCINSQSGVVDHRLVPILARWTRDYTIKSTLQEI
RRIMTLKDNLKLTQPPEGSCF
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g8235.t1 | Gene3D | G3DSA:3.10.110.10 | Ubiquitin Conjugating Enzyme | 1 | 141 | 0.000 |
| 2 | g8235.t1 | PANTHER | PTHR24068:SF169 | UBIQUITIN-CONJUGATING ENZYME E2 VARIANT 1 | 7 | 135 | 0.000 |
| 3 | g8235.t1 | PANTHER | PTHR24068 | UBIQUITIN-CONJUGATING ENZYME E2 | 7 | 135 | 0.000 |
| 1 | g8235.t1 | Pfam | PF00179 | Ubiquitin-conjugating enzyme | 36 | 127 | 0.000 |
| 7 | g8235.t1 | ProSiteProfiles | PS50127 | Ubiquitin-conjugating enzymes family profile. | 11 | 125 | 18.554 |
| 5 | g8235.t1 | SMART | SM00212 | ubc_7 | 11 | 140 | 0.000 |
| 4 | g8235.t1 | SUPERFAMILY | SSF54495 | UBC-like | 6 | 141 | 0.000 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K10704 (ubiquitin-conjugating enzyme E2 variant)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
