General information for g8235.t12
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Ubiquitin-conjugating enzyme E2 variant 2.
Parent gene
- The parent gene g8235 is located on chr_2: 29211433..29212531 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8235 | g8235.t12 | TTS | g8235.t12 | 29210713 | 29210713 |
| chr_2 | g8235 | g8235.t12 | isoform | g8235.t12 | 29211433 | 29212531 |
| chr_2 | g8235 | g8235.t12 | exon | g8235.t12.exon1 | 29211433 | 29211573 |
| chr_2 | g8235 | g8235.t12 | cds | g8235.t12.CDS1 | 29211433 | 29211573 |
| chr_2 | g8235 | g8235.t12 | exon | g8235.t12.exon2 | 29211638 | 29211763 |
| chr_2 | g8235 | g8235.t12 | cds | g8235.t12.CDS2 | 29211638 | 29211763 |
| chr_2 | g8235 | g8235.t12 | exon | g8235.t12.exon3 | 29211970 | 29212082 |
| chr_2 | g8235 | g8235.t12 | cds | g8235.t12.CDS3 | 29211970 | 29212082 |
| chr_2 | g8235 | g8235.t12 | exon | g8235.t12.exon4 | 29212516 | 29212531 |
| chr_2 | g8235 | g8235.t12 | cds | g8235.t12.CDS4 | 29212516 | 29212531 |
| chr_2 | g8235 | g8235.t12 | TSS | g8235.t12 | 29212710 | 29212710 |
Sequences
>g8235.t12 Gene=g8235 Length=396
ATGTCGTCGGGTGTCGAATTGGAAGCTGGTCAAAAAGGAGTTGGTGACGGTACAATTTCA
TGGGGACTAGAAAATGATGATGATATGACTTTGACTCACTGGACTGGAATGATAATTGGG
CCACCAAGAACTCCATACGAGAATAGAATATATTCATTAAAAATAGAATGCGGTAATCGT
TATCCTGATGAGCCACCAACATTGAAATTTCTAACAAAAATCAATATAAATTGTATAAAC
AGTCAGTCTGGTGTGGTTGATCATAGATTAGTTCCAATCTTGGCACGATGGACCCGTGAT
TATACAATCAAATCAACACTGCAAGAAATTCGTAGAATTATGACGCTTAAAGATAATTTA
AAGCTCACGCAACCGCCAGAAGGATCATGCTTTTAA
>g8235.t12 Gene=g8235 Length=131
MSSGVELEAGQKGVGDGTISWGLENDDDMTLTHWTGMIIGPPRTPYENRIYSLKIECGNR
YPDEPPTLKFLTKININCINSQSGVVDHRLVPILARWTRDYTIKSTLQEIRRIMTLKDNL
KLTQPPEGSCF
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g8235.t12 | Gene3D | G3DSA:3.10.110.10 | Ubiquitin Conjugating Enzyme | 4 | 131 | 0.0000000 |
| 2 | g8235.t12 | PANTHER | PTHR24068:SF169 | UBIQUITIN-CONJUGATING ENZYME E2 VARIANT 1 | 11 | 125 | 0.0000000 |
| 3 | g8235.t12 | PANTHER | PTHR24068 | UBIQUITIN-CONJUGATING ENZYME E2 | 11 | 125 | 0.0000000 |
| 1 | g8235.t12 | Pfam | PF00179 | Ubiquitin-conjugating enzyme | 26 | 117 | 0.0000000 |
| 7 | g8235.t12 | ProSiteProfiles | PS50127 | Ubiquitin-conjugating enzymes family profile. | 26 | 115 | 16.9530000 |
| 5 | g8235.t12 | SMART | SM00212 | ubc_7 | 5 | 130 | 0.0000005 |
| 4 | g8235.t12 | SUPERFAMILY | SSF54495 | UBC-like | 6 | 131 | 0.0000000 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed