| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8245 | g8245.t1 | TTS | g8245.t1 | 29271646 | 29271646 |
| chr_2 | g8245 | g8245.t1 | isoform | g8245.t1 | 29271848 | 29272201 |
| chr_2 | g8245 | g8245.t1 | exon | g8245.t1.exon1 | 29271848 | 29272201 |
| chr_2 | g8245 | g8245.t1 | cds | g8245.t1.CDS1 | 29271848 | 29272201 |
| chr_2 | g8245 | g8245.t1 | TSS | g8245.t1 | 29272243 | 29272243 |
>g8245.t1 Gene=g8245 Length=354
ATGGCACCACCAAAAACAAGCGGTAAAGCAGCAAAGAAAGCCGGAAAGGCACAGAAAAAT
ATTTCAAAGGATGACAAGAAGAAGAAACGTCATCGTCGTAAGGAATCATATGCAATTTAC
ATCTTCAAAGTCTTGAAACAAGTTCATCCTGATACTGGTATTTCATCAAAGGCAATGAGC
ATCATGAACTCATTTGTTAACGACATTTTGAACGCATTGCTGCTGAGGCATCACGTTTGG
CTCACTACAACAAACGCTCAACAATCACATCACGAGAAATCCAAACAGCAGTTCGTCTTC
TCTTGCCTGGTGAATTGGCTAAGCATGCTGTCTCAGAAGGCACAAAAGCTGTAA
>g8245.t1 Gene=g8245 Length=117
MAPPKTSGKAAKKAGKAQKNISKDDKKKKRHRRKESYAIYIFKVLKQVHPDTGISSKAMS
IMNSFVNDILNALLLRHHVWLTTTNAQQSHHEKSKQQFVFSCLVNWLSMLSQKAQKL
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g8245.t1 | Gene3D | G3DSA:1.10.20.10 | Histone | 1 | 109 | 7.8E-28 |
| 8 | g8245.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 33 | - |
| 2 | g8245.t1 | PANTHER | PTHR23428:SF288 | HISTONE H2B TYPE 2-C-RELATED | 3 | 71 | 2.2E-27 |
| 3 | g8245.t1 | PANTHER | PTHR23428 | HISTONE H2B | 3 | 71 | 2.2E-27 |
| 5 | g8245.t1 | PRINTS | PR00621 | Histone H2B signature | 37 | 55 | 1.1E-15 |
| 4 | g8245.t1 | PRINTS | PR00621 | Histone H2B signature | 56 | 76 | 1.1E-15 |
| 1 | g8245.t1 | Pfam | PF00125 | Core histone H2A/H2B/H3/H4 | 6 | 74 | 2.9E-10 |
| 7 | g8245.t1 | SMART | SM00427 | h2b3 | 27 | 88 | 3.7E-10 |
| 6 | g8245.t1 | SUPERFAMILY | SSF47113 | Histone-fold | 9 | 74 | 8.38E-23 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003677 | DNA binding | MF |
| GO:0046982 | protein heterodimerization activity | MF |
| GO:0000786 | nucleosome | CC |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.