| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8279 | g8279.t7 | isoform | g8279.t7 | 29536635 | 29538753 |
| chr_2 | g8279 | g8279.t7 | exon | g8279.t7.exon1 | 29536635 | 29537278 |
| chr_2 | g8279 | g8279.t7 | cds | g8279.t7.CDS1 | 29536637 | 29537278 |
| chr_2 | g8279 | g8279.t7 | exon | g8279.t7.exon2 | 29537341 | 29537465 |
| chr_2 | g8279 | g8279.t7 | cds | g8279.t7.CDS2 | 29537341 | 29537465 |
| chr_2 | g8279 | g8279.t7 | exon | g8279.t7.exon3 | 29537615 | 29537806 |
| chr_2 | g8279 | g8279.t7 | cds | g8279.t7.CDS3 | 29537615 | 29537806 |
| chr_2 | g8279 | g8279.t7 | exon | g8279.t7.exon4 | 29537870 | 29538036 |
| chr_2 | g8279 | g8279.t7 | cds | g8279.t7.CDS4 | 29537870 | 29537945 |
| chr_2 | g8279 | g8279.t7 | exon | g8279.t7.exon5 | 29538727 | 29538753 |
| chr_2 | g8279 | g8279.t7 | TSS | g8279.t7 | 29538753 | 29538753 |
| chr_2 | g8279 | g8279.t7 | TTS | g8279.t7 | NA | NA |
>g8279.t7 Gene=g8279 Length=1155
GTGGAATTTTTCATATACAATAAAAAGATTCTTGCAGATAATTTATATTTTTGTTGTGTG
AAAAGTTGAAACAATTAAATCAGCAAAAGTGAAGGTGAAAAAGATATCACAAGACAAGAT
GATTAATCGGCGTATGATTCTTGTAAGCGATGGTCAGAATACTGGCCAACATCGAGTCAT
TACGTCTAGTGGAGGAAATACAATATTAGATGGAAAAACGCAAACCGTTTACACAACAAG
TGATAAGACTACACATTTCATGAGTCCTATAGGATCACTTCAATTGACTGCCGAAGAATG
TAATGAAATTTTAATGAAACGTGCAGTTGCTGCAGTACAAAATCAGCAAGCAATTACCAC
AACGGCCTCAGATTCGCATAGTGCACCAATATCAATTCAAGTTCAGAAGGTCCTACAAAC
ACTAGAAGACAGTGACGAACAACAGTTAACTCATTGCAAAATGGAACCAAATATGAGTTC
ATCACCAAAATTGGAAACGATTGAAATTGTCCATTTTGAAACTGCAGAAGACACGAAACC
GATAATTCATAAAACACGCAAGAATGATCCAGGAAGTAGTAAAGAACGTCCTTATGCTTG
TGAACAATGTGGCAAAACATTTTTATTAAAACATCATTTGACAACTCATGCTCGAAGTCA
TACAGGAGAGCGTCCACACGTTTGTCCTCATTGCGGAAAAGATTTTAGCCATAAACACTG
CTTAAACACTCATTTACTGTTGCATACAACTGAACGGCCATATCAATGTGGAGAGTGTAA
AAAATGTTTTACTTTAAAACATCACTTGTTGACACATTTAAGGGTTCATACTCGCGATCG
TCCATTTGTATGCCAAGAATGTGGTCGATCTTTTCCATTGAAACGTCATTTAGTAACACA
CAGCAAGTTTCATGCTGGCGAGAGGCCTTATATTTGTGATGATTGTGGAGAAAGCTTTTC
ACAGAAAGAACATTTAGATATGCATTCAAGATTCCATGGATCTGTGAATCCATTTGCATG
TAACGATTGCGGTGCCACATTTGCTCGTAAATTTCAATTGATAAATCATGGGAAATTGCA
TGGTAGAGTTCCACATTCTTGTACTGTTTGTGGTCGGGAATTTTTGCAAAAACGCACATT
AGCAACTCATATGAA
>g8279.t7 Gene=g8279 Length=345
MINRRMILVSDGQNTGQHRVITSSGGNTILDGKTQTVYTTSDKTTHFMSPIGSLQLTAEE
CNEILMKRAVAAVQNQQAITTTASDSHSAPISIQVQKVLQTLEDSDEQQLTHCKMEPNMS
SSPKLETIEIVHFETAEDTKPIIHKTRKNDPGSSKERPYACEQCGKTFLLKHHLTTHARS
HTGERPHVCPHCGKDFSHKHCLNTHLLLHTTERPYQCGECKKCFTLKHHLLTHLRVHTRD
RPFVCQECGRSFPLKRHLVTHSKFHAGERPYICDDCGESFSQKEHLDMHSRFHGSVNPFA
CNDCGATFARKFQLINHGKLHGRVPHSCTVCGREFLQKRTLATHM
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 31 | g8279.t7 | Gene3D | G3DSA:3.30.160.60 | Classic Zinc Finger | 150 | 182 | 7.2E-13 |
| 30 | g8279.t7 | Gene3D | G3DSA:3.30.160.60 | Classic Zinc Finger | 183 | 211 | 5.5E-12 |
| 28 | g8279.t7 | Gene3D | G3DSA:3.30.160.60 | Classic Zinc Finger | 212 | 237 | 1.8E-11 |
| 29 | g8279.t7 | Gene3D | G3DSA:3.30.160.60 | Classic Zinc Finger | 238 | 264 | 1.5E-10 |
| 27 | g8279.t7 | Gene3D | G3DSA:3.30.160.60 | Classic Zinc Finger | 265 | 291 | 3.6E-10 |
| 26 | g8279.t7 | Gene3D | G3DSA:3.30.160.60 | Classic Zinc Finger | 292 | 345 | 1.6E-12 |
| 5 | g8279.t7 | PANTHER | PTHR24377:SF889 | ZINC FINGER PROTEIN 774 | 146 | 293 | 1.2E-104 |
| 7 | g8279.t7 | PANTHER | PTHR24377 | IP01015P-RELATED | 146 | 293 | 1.2E-104 |
| 6 | g8279.t7 | PANTHER | PTHR24377:SF889 | ZINC FINGER PROTEIN 774 | 154 | 344 | 1.2E-104 |
| 8 | g8279.t7 | PANTHER | PTHR24377 | IP01015P-RELATED | 154 | 344 | 1.2E-104 |
| 4 | g8279.t7 | Pfam | PF00096 | Zinc finger, C2H2 type | 215 | 237 | 0.0049 |
| 3 | g8279.t7 | Pfam | PF00096 | Zinc finger, C2H2 type | 243 | 265 | 0.0073 |
| 2 | g8279.t7 | Pfam | PF00096 | Zinc finger, C2H2 type | 271 | 293 | 9.6E-4 |
| 1 | g8279.t7 | Pfam | PF00096 | Zinc finger, C2H2 type | 299 | 321 | 0.0011 |
| 23 | g8279.t7 | ProSitePatterns | PS00028 | Zinc finger C2H2 type domain signature. | 161 | 181 | - |
| 22 | g8279.t7 | ProSitePatterns | PS00028 | Zinc finger C2H2 type domain signature. | 189 | 209 | - |
| 25 | g8279.t7 | ProSitePatterns | PS00028 | Zinc finger C2H2 type domain signature. | 217 | 237 | - |
| 21 | g8279.t7 | ProSitePatterns | PS00028 | Zinc finger C2H2 type domain signature. | 245 | 265 | - |
| 24 | g8279.t7 | ProSitePatterns | PS00028 | Zinc finger C2H2 type domain signature. | 273 | 293 | - |
| 20 | g8279.t7 | ProSitePatterns | PS00028 | Zinc finger C2H2 type domain signature. | 301 | 321 | - |
| 35 | g8279.t7 | ProSiteProfiles | PS50157 | Zinc finger C2H2 type domain profile. | 159 | 186 | 16.893 |
| 36 | g8279.t7 | ProSiteProfiles | PS50157 | Zinc finger C2H2 type domain profile. | 187 | 214 | 13.817 |
| 33 | g8279.t7 | ProSiteProfiles | PS50157 | Zinc finger C2H2 type domain profile. | 215 | 242 | 15.064 |
| 38 | g8279.t7 | ProSiteProfiles | PS50157 | Zinc finger C2H2 type domain profile. | 243 | 270 | 15.667 |
| 34 | g8279.t7 | ProSiteProfiles | PS50157 | Zinc finger C2H2 type domain profile. | 271 | 298 | 13.588 |
| 32 | g8279.t7 | ProSiteProfiles | PS50157 | Zinc finger C2H2 type domain profile. | 299 | 321 | 10.907 |
| 37 | g8279.t7 | ProSiteProfiles | PS50157 | Zinc finger C2H2 type domain profile. | 326 | 345 | 9.556 |
| 17 | g8279.t7 | SMART | SM00355 | c2h2final6 | 159 | 181 | 0.044 |
| 16 | g8279.t7 | SMART | SM00355 | c2h2final6 | 187 | 209 | 0.35 |
| 19 | g8279.t7 | SMART | SM00355 | c2h2final6 | 215 | 237 | 0.12 |
| 15 | g8279.t7 | SMART | SM00355 | c2h2final6 | 243 | 265 | 0.035 |
| 14 | g8279.t7 | SMART | SM00355 | c2h2final6 | 271 | 293 | 0.014 |
| 13 | g8279.t7 | SMART | SM00355 | c2h2final6 | 299 | 321 | 0.89 |
| 18 | g8279.t7 | SMART | SM00355 | c2h2final6 | 326 | 345 | 140.0 |
| 12 | g8279.t7 | SUPERFAMILY | SSF57667 | beta-beta-alpha zinc fingers | 155 | 205 | 9.34E-16 |
| 10 | g8279.t7 | SUPERFAMILY | SSF57667 | beta-beta-alpha zinc fingers | 196 | 252 | 8.03E-17 |
| 9 | g8279.t7 | SUPERFAMILY | SSF57667 | beta-beta-alpha zinc fingers | 251 | 308 | 1.25E-16 |
| 11 | g8279.t7 | SUPERFAMILY | SSF57667 | beta-beta-alpha zinc fingers | 298 | 345 | 1.03E-9 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.