General information for g8400.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g8400 is located on chr_2: 30155053..30155623 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8400 | g8400.t1 | TTS | g8400.t1 | 30154834 | 30154834 |
| chr_2 | g8400 | g8400.t1 | isoform | g8400.t1 | 30155053 | 30155623 |
| chr_2 | g8400 | g8400.t1 | exon | g8400.t1.exon1 | 30155053 | 30155065 |
| chr_2 | g8400 | g8400.t1 | cds | g8400.t1.CDS1 | 30155053 | 30155065 |
| chr_2 | g8400 | g8400.t1 | exon | g8400.t1.exon2 | 30155311 | 30155468 |
| chr_2 | g8400 | g8400.t1 | cds | g8400.t1.CDS2 | 30155311 | 30155468 |
| chr_2 | g8400 | g8400.t1 | exon | g8400.t1.exon3 | 30155555 | 30155623 |
| chr_2 | g8400 | g8400.t1 | cds | g8400.t1.CDS3 | 30155555 | 30155623 |
| chr_2 | g8400 | g8400.t1 | TSS | g8400.t1 | 30155720 | 30155720 |
Sequences
>g8400.t1 Gene=g8400 Length=240
ATGGAACAAACAAACTACTCTATTAACAGTAATATTGATCCAAAGAATAATGAGGAACTA
ATTATTTATGTTCAAAACCTTCTGCAAAATGTGCAAGATAAATTTCAATGCATGAGCGAA
CAGATAATCGGGCGAATTGATGAGATGGGAAATCGCATTGATGACTTAGAGAAGAGCATT
TCAGAATTAATGCAGCAAGCGGGTGTCTCTGAGCAAACAATTGACAAGACACAGAGCTAA
>g8400.t1 Gene=g8400 Length=79
MEQTNYSINSNIDPKNNEELIIYVQNLLQNVQDKFQCMSEQIIGRIDEMGNRIDDLEKSI
SELMQQAGVSEQTIDKTQS
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 5 | g8400.t1 | Coils | Coil | Coil | 46 | 73 | - |
| 4 | g8400.t1 | Gene3D | G3DSA:1.20.5.430 | - | 14 | 61 | 1.0E-24 |
| 2 | g8400.t1 | PANTHER | PTHR19424 | HEAT SHOCK FACTOR BINDING PROTEIN 1 | 12 | 72 | 6.1E-21 |
| 3 | g8400.t1 | PANTHER | PTHR19424:SF3 | HEAT SHOCK FACTOR-BINDING PROTEIN 1 | 12 | 72 | 6.1E-21 |
| 1 | g8400.t1 | Pfam | PF06825 | Heat shock factor binding protein 1 | 18 | 68 | 2.6E-26 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003714 | transcription corepressor activity | MF |
KEGG
Orthology
- This transcript has been annotated with K19765 (heat shock factor-binding protein 1)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
