General information for g8517.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Ubiquitin-conjugating enzyme E2-22 kDa.
Parent gene
- The parent gene g8517 is located on chr_2: 31111296..31112063 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8517 | g8517.t1 | TSS | g8517.t1 | 31111177 | 31111177 |
| chr_2 | g8517 | g8517.t1 | isoform | g8517.t1 | 31111296 | 31112062 |
| chr_2 | g8517 | g8517.t1 | exon | g8517.t1.exon1 | 31111296 | 31111343 |
| chr_2 | g8517 | g8517.t1 | cds | g8517.t1.CDS1 | 31111296 | 31111343 |
| chr_2 | g8517 | g8517.t1 | exon | g8517.t1.exon2 | 31111431 | 31111448 |
| chr_2 | g8517 | g8517.t1 | cds | g8517.t1.CDS2 | 31111431 | 31111448 |
| chr_2 | g8517 | g8517.t1 | exon | g8517.t1.exon3 | 31111719 | 31111966 |
| chr_2 | g8517 | g8517.t1 | cds | g8517.t1.CDS3 | 31111719 | 31111966 |
| chr_2 | g8517 | g8517.t1 | exon | g8517.t1.exon4 | 31112023 | 31112062 |
| chr_2 | g8517 | g8517.t1 | cds | g8517.t1.CDS4 | 31112023 | 31112062 |
| chr_2 | g8517 | g8517.t1 | TTS | g8517.t1 | NA | NA |
Sequences
>g8517.t1 Gene=g8517 Length=354
ATGGCTGTCAACATGGCAATTAGTCGCATTAAGCGTGAATTTAAAGAAGTCTTAAAGAGT
GATGAGATAACTCAATGTGCAATCAAGTTGGAGTTGCAGAATGACTCATTCACTGATCTT
CGTGGAGAGATTACTGGACCACCTGATACGCCTTATGAAAATGGCACATTTTTGCTTGAA
ATTCATATTCCAGAAACGTATCCATTTAATCCACCAAAAGTCAAGTTTATAACAAAGATT
TGGCATCCGAATATAAGCAGTGTTACTGGCGCTATTTGTTTGGATATACTTAAAGACAGC
TGGGCGGCCGCAATGACTATCGTAAGTACATACCAATGGAAATTTTCAACATAA
>g8517.t1 Gene=g8517 Length=117
MAVNMAISRIKREFKEVLKSDEITQCAIKLELQNDSFTDLRGEITGPPDTPYENGTFLLE
IHIPETYPFNPPKVKFITKIWHPNISSVTGAICLDILKDSWAAAMTIVSTYQWKFST
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g8517.t1 | CDD | cd00195 | UBCc | 7 | 109 | 4.73341E-41 |
| 5 | g8517.t1 | Gene3D | G3DSA:3.10.110.10 | Ubiquitin Conjugating Enzyme | 2 | 112 | 5.3E-44 |
| 2 | g8517.t1 | PANTHER | PTHR24068:SF147 | UBIQUITIN-CONJUGATING ENZYME E2 K | 7 | 108 | 1.1E-35 |
| 3 | g8517.t1 | PANTHER | PTHR24068 | UBIQUITIN-CONJUGATING ENZYME E2 | 7 | 108 | 1.1E-35 |
| 1 | g8517.t1 | Pfam | PF00179 | Ubiquitin-conjugating enzyme | 9 | 109 | 3.3E-31 |
| 7 | g8517.t1 | ProSitePatterns | PS00183 | Ubiquitin-conjugating enzymes active site. | 81 | 97 | - |
| 9 | g8517.t1 | ProSiteProfiles | PS50127 | Ubiquitin-conjugating enzymes family profile. | 8 | 107 | 27.766 |
| 8 | g8517.t1 | SMART | SM00212 | ubc_7 | 8 | 117 | 5.4E-23 |
| 4 | g8517.t1 | SUPERFAMILY | SSF54495 | UBC-like | 3 | 109 | 2.62E-36 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K04649 (ubiquitin-conjugating enzyme (huntingtin interacting protein 2))
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
