| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8553 | g8553.t1 | isoform | g8553.t1 | 31281291 | 31281896 |
| chr_2 | g8553 | g8553.t1 | exon | g8553.t1.exon1 | 31281291 | 31281498 |
| chr_2 | g8553 | g8553.t1 | cds | g8553.t1.CDS1 | 31281291 | 31281498 |
| chr_2 | g8553 | g8553.t1 | exon | g8553.t1.exon2 | 31281553 | 31281896 |
| chr_2 | g8553 | g8553.t1 | cds | g8553.t1.CDS2 | 31281553 | 31281896 |
| chr_2 | g8553 | g8553.t1 | TSS | g8553.t1 | NA | NA |
| chr_2 | g8553 | g8553.t1 | TTS | g8553.t1 | NA | NA |
>g8553.t1 Gene=g8553 Length=552
ATGGCCTTTTCAATTCTAACTTTACATGATTGTCGTCTTGAAGGATTTTGGAACAGATTA
ATTTTAAATGGAATGAAAATATCTGAATTTTTTATTTCAAATATTATTCAATACTTTATG
AATTCAACAATTATAACAATTGAAATGATGCTGTTATTAAAAATTTTACTACAAATTGAA
ATATTAGGCAGTTGTAGACTTGCCTTTTTAATAATATTTCTAACAGCATTTGATGGGTTT
CTTTGTGGATTAATTACATCTATTATATTTGATAATCTTTTTATTATTGCTGGATTTGGA
TTTCACTTTTCGTTTTTATCAATGTCATTATCTGGAATAGTATGGCCAATTGAAGGAGCT
TCAAAATATATTCAACCTTTGGTTTATCTTTATCCACTTACGATGCCAGCAGATGCTCTA
CGAGATATATATTTCAAAGGATCTAATTTATTAAATTTTGATATTCAATTGGCCTTATTT
TATTTAATATTCTGCACTTTATTCCACTGTTTTTTATGCTTGATAGTTTTAAAATATAAA
ATATTTAAATAA
>g8553.t1 Gene=g8553 Length=183
MAFSILTLHDCRLEGFWNRLILNGMKISEFFISNIIQYFMNSTIITIEMMLLLKILLQIE
ILGSCRLAFLIIFLTAFDGFLCGLITSIIFDNLFIIAGFGFHFSFLSMSLSGIVWPIEGA
SKYIQPLVYLYPLTMPADALRDIYFKGSNLLNFDIQLALFYLIFCTLFHCFLCLIVLKYK
IFK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g8553.t1 | PANTHER | PTHR43038 | ATP-BINDING CASSETTE, SUB-FAMILY H, MEMBER 1 | 12 | 180 | 1.3E-16 |
| 3 | g8553.t1 | PANTHER | PTHR43038:SF2 | RH61964P | 12 | 180 | 1.3E-16 |
| 1 | g8553.t1 | Pfam | PF01061 | ABC-2 type transporter | 14 | 145 | 2.4E-12 |
| 13 | g8553.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 34 | - |
| 18 | g8553.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 35 | 57 | - |
| 10 | g8553.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 58 | 68 | - |
| 15 | g8553.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 69 | 89 | - |
| 12 | g8553.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 90 | 94 | - |
| 17 | g8553.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 95 | 115 | - |
| 9 | g8553.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 116 | 126 | - |
| 16 | g8553.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 127 | 145 | - |
| 11 | g8553.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 146 | 156 | - |
| 14 | g8553.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 157 | 177 | - |
| 8 | g8553.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 178 | 183 | - |
| 5 | g8553.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 31 | 53 | - |
| 6 | g8553.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 68 | 90 | - |
| 4 | g8553.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 95 | 117 | - |
| 7 | g8553.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 155 | 177 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016020 | membrane | CC |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed