General information for g8637.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Cytochrome c oxidase subunit 6A1, mitochondrial.
Parent gene
- The parent gene g8637 is located on chr_2: 31957168..31960170 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8637 | g8637.t1 | TSS | g8637.t1 | 31956801 | 31956801 |
| chr_2 | g8637 | g8637.t1 | isoform | g8637.t1 | 31956855 | 31957466 |
| chr_2 | g8637 | g8637.t1 | exon | g8637.t1.exon1 | 31956855 | 31956942 |
| chr_2 | g8637 | g8637.t1 | cds | g8637.t1.CDS1 | 31956855 | 31956942 |
| chr_2 | g8637 | g8637.t1 | exon | g8637.t1.exon2 | 31957170 | 31957357 |
| chr_2 | g8637 | g8637.t1 | cds | g8637.t1.CDS2 | 31957170 | 31957357 |
| chr_2 | g8637 | g8637.t1 | exon | g8637.t1.exon3 | 31957419 | 31957466 |
| chr_2 | g8637 | g8637.t1 | cds | g8637.t1.CDS3 | 31957419 | 31957466 |
| chr_2 | g8637 | g8637.t1 | TTS | g8637.t1 | 31957583 | 31957583 |
Sequences
>g8637.t1 Gene=g8637 Length=324
ATGGCTTCACAAGTTTTCAAGAGAGGCATTCAAACAGCTTCAGCTAATTTTGCCAGCCCA
GGAACTGCAGCAACAGCCGGTCATGGAGGTGGCTGGAAATTGTGGAAAAGATTGTCCTTC
TTCGTTGCTTTGCCAGGTGTTGGTGTCTGCATGTTAAACACATATTTGGAACATCAGAAA
CACGGACATGAAAGACCAGAATTCGTACCATACGAATATTTAAGAATTCGCAACAAGAGA
TTTCCATGGGGTGATGGAAATCACAGCTTATTCCATAACCCACATGTAAATGCATTGCCA
ACTGGTTATGAAGATGAACATTAA
>g8637.t1 Gene=g8637 Length=107
MASQVFKRGIQTASANFASPGTAATAGHGGGWKLWKRLSFFVALPGVGVCMLNTYLEHQK
HGHERPEFVPYEYLRIRNKRFPWGDGNHSLFHNPHVNALPTGYEDEH
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g8637.t1 | CDD | cd00925 | Cyt_c_Oxidase_VIa | 22 | 104 | 9.05131E-45 |
| 5 | g8637.t1 | Gene3D | G3DSA:4.10.95.10 | Cytochrome C Oxidase | 21 | 106 | 7.4E-39 |
| 2 | g8637.t1 | PANTHER | PTHR11504:SF7 | CYTOCHROME C OXIDASE SUBUNIT 6A, MITOCHONDRIAL | 13 | 105 | 3.7E-40 |
| 3 | g8637.t1 | PANTHER | PTHR11504 | CYTOCHROME C OXIDASE POLYPEPTIDE VIA | 13 | 105 | 3.7E-40 |
| 9 | g8637.t1 | PIRSF | PIRSF000277 | COX_VIa | 1 | 105 | 1.2E-39 |
| 1 | g8637.t1 | Pfam | PF02046 | Cytochrome c oxidase subunit VIa | 22 | 97 | 1.0E-18 |
| 7 | g8637.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 37 | - |
| 8 | g8637.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 38 | 56 | - |
| 6 | g8637.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 57 | 107 | - |
| 11 | g8637.t1 | ProSitePatterns | PS01329 | Cytochrome c oxidase subunit VIa signature. | 76 | 93 | - |
| 4 | g8637.t1 | SUPERFAMILY | SSF81411 | Mitochondrial cytochrome c oxidase subunit VIa | 26 | 105 | 8.76E-34 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0004129 | cytochrome-c oxidase activity | MF |
| GO:0005743 | mitochondrial inner membrane | CC |
| GO:0005751 | mitochondrial respiratory chain complex IV | CC |
KEGG
Orthology
- This transcript has been annotated with K02266 (cytochrome c oxidase subunit 6a)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
