| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8645 | g8645.t7 | TTS | g8645.t7 | 32079417 | 32079417 |
| chr_2 | g8645 | g8645.t7 | isoform | g8645.t7 | 32079537 | 32080360 |
| chr_2 | g8645 | g8645.t7 | exon | g8645.t7.exon1 | 32079537 | 32079590 |
| chr_2 | g8645 | g8645.t7 | exon | g8645.t7.exon2 | 32079672 | 32079762 |
| chr_2 | g8645 | g8645.t7 | cds | g8645.t7.CDS1 | 32079733 | 32079762 |
| chr_2 | g8645 | g8645.t7 | exon | g8645.t7.exon3 | 32079813 | 32079865 |
| chr_2 | g8645 | g8645.t7 | cds | g8645.t7.CDS2 | 32079813 | 32079865 |
| chr_2 | g8645 | g8645.t7 | exon | g8645.t7.exon4 | 32079947 | 32080031 |
| chr_2 | g8645 | g8645.t7 | cds | g8645.t7.CDS3 | 32079947 | 32080031 |
| chr_2 | g8645 | g8645.t7 | exon | g8645.t7.exon5 | 32080110 | 32080360 |
| chr_2 | g8645 | g8645.t7 | cds | g8645.t7.CDS4 | 32080110 | 32080235 |
| chr_2 | g8645 | g8645.t7 | TSS | g8645.t7 | 32080466 | 32080466 |
>g8645.t7 Gene=g8645 Length=534
AGTTTGATTGCTTTTCTAATACTCGCAAGCTGTGTTCACACATTTTTAGTATATTATTTA
TATTTCTCTGCTTCAGTCTAAATTTCACTTGCGATCTTGAAAACGAAAAAAGCAGAAGTA
ACAACATGGCAAATAATGAAAGAACTTTTATCATGTGCAAGCCTGATGCCGTTCAACGCG
GAATTGTTGGAGAAATAATCAAACGCTTCGAAACAAAAGGTTTCAAACTCGTTGGAATGA
AATTTATGTGGGCATCCAAAGATCTTTTGGAGAAACATTATGCCGATTTAAGCTCACGTC
CCTTCTTCCCAGGTCTTGTTAATTACATGTCATCAGGTCCTGTTGTTCCAATGGTTTGGG
AAGGATTAAATGCAGTCAAAACAGGCAGAAGGAGATTTGTGCGTTCAAGTTGGTCGTAAT
ATAATCCACGGCTCTGACTCTGTTGAGAGTGCAAAGAAAGAAATCGCATTGTGGTTCAAT
GAGAATGAGTTGGTCAACTGGACACCAGCAGCTGTTAATTGGGTTTATGAATAA
>g8645.t7 Gene=g8645 Length=97
MANNERTFIMCKPDAVQRGIVGEIIKRFETKGFKLVGMKFMWASKDLLEKHYADLSSRPF
FPGLVNYMSSGPVVPMVWEGLNAVKTGRRRFVRSSWS
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 12 | g8645.t7 | CDD | cd04413 | NDPk_I | 5 | 89 | 0 |
| 11 | g8645.t7 | Gene3D | G3DSA:3.30.70.141 | - | 1 | 93 | 0 |
| 3 | g8645.t7 | PANTHER | PTHR11349 | NUCLEOSIDE DIPHOSPHATE KINASE | 1 | 64 | 0 |
| 5 | g8645.t7 | PANTHER | PTHR11349:SF103 | NUCLEOSIDE DIPHOSPHATE KINASE | 1 | 64 | 0 |
| 2 | g8645.t7 | PANTHER | PTHR11349 | NUCLEOSIDE DIPHOSPHATE KINASE | 63 | 88 | 0 |
| 4 | g8645.t7 | PANTHER | PTHR11349:SF103 | NUCLEOSIDE DIPHOSPHATE KINASE | 63 | 88 | 0 |
| 6 | g8645.t7 | PRINTS | PR01243 | Nucleoside diphosphate kinase signature | 7 | 29 | 0 |
| 8 | g8645.t7 | PRINTS | PR01243 | Nucleoside diphosphate kinase signature | 51 | 70 | 0 |
| 7 | g8645.t7 | PRINTS | PR01243 | Nucleoside diphosphate kinase signature | 71 | 88 | 0 |
| 1 | g8645.t7 | Pfam | PF00334 | Nucleoside diphosphate kinase | 5 | 89 | 0 |
| 10 | g8645.t7 | SMART | SM00562 | ndk_5 | 4 | 93 | 0 |
| 9 | g8645.t7 | SUPERFAMILY | SSF54919 | Nucleoside diphosphate kinase, NDK | 3 | 89 | 0 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006228 | UTP biosynthetic process | BP |
| GO:0006241 | CTP biosynthetic process | BP |
| GO:0006165 | nucleoside diphosphate phosphorylation | BP |
| GO:0004550 | nucleoside diphosphate kinase activity | MF |
| GO:0006183 | GTP biosynthetic process | BP |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.