General information for g876.t22
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g876 is located on chr_3: 6617556..6626867 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g876 | g876.t22 | isoform | g876.t22 | 6617556 | 6617900 |
| chr_3 | g876 | g876.t22 | exon | g876.t22.exon1 | 6617556 | 6617900 |
| chr_3 | g876 | g876.t22 | cds | g876.t22.CDS1 | 6617636 | 6617899 |
| chr_3 | g876 | g876.t22 | TTS | g876.t22 | 6617993 | 6617993 |
| chr_3 | g876 | g876.t22 | TSS | g876.t22 | NA | NA |
Sequences
>g876.t22 Gene=g876 Length=345
GCTATGGTTTGCAAGTTTATTTTAAAGACATTTCTGAAGAAACTATTGAATCTGCACTTA
AAGAATTATTGAACAATCCAATGTACAAAGAAAATGCAAAAATTATTTCAAAACGCTTTA
ATGATCGACCAATGACACCACAACAATCAGTAGTTTATTGGACTGAATATGTTCATAGAC
ATGACGGAGCGCCACACTTGAAAGCTGCTGCAATTGATTTGGATTTTATCGCATTTCACA
TGATTGATATTTATGCTGTTTTAATATTCATCACAATTTTAATTATTTATATTGATTATT
TAATTCTCAAATGGCTTTTTAGAAAATGTTTTGGAAAATCAAAGA
>g876.t22 Gene=g876 Length=88
MYKENAKIISKRFNDRPMTPQQSVVYWTEYVHRHDGAPHLKAAAIDLDFIAFHMIDIYAV
LIFITILIIYIDYLILKWLFRKCFGKSK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g876.t22 | PANTHER | PTHR48043:SF60 | UDP-GLUCURONOSYLTRANSFERASE | 2 | 70 | 3.4E-15 |
| 3 | g876.t22 | PANTHER | PTHR48043 | EG:EG0003.4 PROTEIN-RELATED | 2 | 70 | 3.4E-15 |
| 1 | g876.t22 | Pfam | PF00201 | UDP-glucoronosyl and UDP-glucosyl transferase | 1 | 87 | 4.3E-20 |
| 7 | g876.t22 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 56 | - |
| 8 | g876.t22 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 57 | 80 | - |
| 6 | g876.t22 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 81 | 88 | - |
| 5 | g876.t22 | SUPERFAMILY | SSF53756 | UDP-Glycosyltransferase/glycogen phosphorylase | 2 | 40 | 2.13E-7 |
| 4 | g876.t22 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 49 | 71 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0008194 | UDP-glycosyltransferase activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed