| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8792 | g8792.t1 | isoform | g8792.t1 | 33159454 | 33160402 |
| chr_2 | g8792 | g8792.t1 | exon | g8792.t1.exon1 | 33159454 | 33159483 |
| chr_2 | g8792 | g8792.t1 | cds | g8792.t1.CDS1 | 33159454 | 33159483 |
| chr_2 | g8792 | g8792.t1 | exon | g8792.t1.exon2 | 33160157 | 33160402 |
| chr_2 | g8792 | g8792.t1 | cds | g8792.t1.CDS2 | 33160157 | 33160402 |
| chr_2 | g8792 | g8792.t1 | TSS | g8792.t1 | 33160704 | 33160704 |
| chr_2 | g8792 | g8792.t1 | TTS | g8792.t1 | NA | NA |
>g8792.t1 Gene=g8792 Length=276
ATGGCTTTGAATAAGACGGCCTTTTCAAAGAGGGCTGAACAATTGAAAAGATATGAAGAC
TCGGAAACTAATCGCGAGTCTGTAGTGCCAAAGAATCCAAATGAAAGAAAAGTTAGATTT
TCGGCTGGTTGCATTTTTCTTGCGGCTTGTGCTGCTGGTGATAAAGATGAAGTGCTAAAT
ATGCTCAACAGTGGAGGAGCTGATATAGATACTGCTAATGTCGATGGTCTAACAGCATTG
CATCAAATACTTTTAATTACATTCATTCGATTATAA
>g8792.t1 Gene=g8792 Length=91
MALNKTAFSKRAEQLKRYEDSETNRESVVPKNPNERKVRFSAGCIFLAACAAGDKDEVLN
MLNSGGADIDTANVDGLTALHQILLITFIRL
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g8792.t1 | Gene3D | G3DSA:1.25.40.20 | - | 3 | 85 | 3.8E-13 |
| 5 | g8792.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 33 | - |
| 4 | g8792.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 10 | 33 | - |
| 1 | g8792.t1 | PANTHER | PTHR24179 | PROTEIN PHOSPHATASE 1 REGULATORY SUBUNIT 12 | 4 | 82 | 5.8E-31 |
| 2 | g8792.t1 | PANTHER | PTHR24179:SF21 | MYOSIN BINDING SUBUNIT, ISOFORM O | 4 | 82 | 5.8E-31 |
| 7 | g8792.t1 | ProSiteProfiles | PS50297 | Ankyrin repeat region circular profile. | 49 | 81 | 9.516 |
| 3 | g8792.t1 | SUPERFAMILY | SSF48403 | Ankyrin repeat | 43 | 81 | 1.9E-5 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed