General information for g8914.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g8914 is located on chr_2: 33787374..33788096 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8914 | g8914.t1 | isoform | g8914.t1 | 33787374 | 33788096 |
| chr_2 | g8914 | g8914.t1 | exon | g8914.t1.exon1 | 33787374 | 33787694 |
| chr_2 | g8914 | g8914.t1 | cds | g8914.t1.CDS1 | 33787374 | 33787694 |
| chr_2 | g8914 | g8914.t1 | exon | g8914.t1.exon2 | 33787761 | 33787847 |
| chr_2 | g8914 | g8914.t1 | cds | g8914.t1.CDS2 | 33787761 | 33787847 |
| chr_2 | g8914 | g8914.t1 | exon | g8914.t1.exon3 | 33788094 | 33788096 |
| chr_2 | g8914 | g8914.t1 | cds | g8914.t1.CDS3 | 33788094 | 33788096 |
| chr_2 | g8914 | g8914.t1 | TSS | g8914.t1 | NA | NA |
| chr_2 | g8914 | g8914.t1 | TTS | g8914.t1 | NA | NA |
Sequences
>g8914.t1 Gene=g8914 Length=411
ATGGAAATGTCATCAAAAAATACTAAAAGAAATGAAAAGCATAGTGATGATGATCCTGCA
TATTCAGAAAAACGAAAACGAAATAATGAGGCTGTCAGAAAGTCTCGAGATAAATCTAAG
AAGAAAGCTGAAGAGACAATGGCAAAGGTACAAAAATTAAAAGAAGAAAATAAAAAATTG
GAGAGTAAAATTGATGAGCAAAAGAAAACAAAAAAATTTCTTAAAGACCTTTTCTTACAA
CAAACAACTTCAAAAATACAAAATCCGACATCAGAACAATTGACTTTAATAAATGAAGAA
AACTCTGAGGATGATATTGAATCAGAATTTTCAACACAATCATCTGTTGAAGAATCATCT
TCATCGTCTGAAGAAGAGCCAACTTCAAAAAGCAAAAGAACGAAAAAATAA
>g8914.t1 Gene=g8914 Length=136
MEMSSKNTKRNEKHSDDDPAYSEKRKRNNEAVRKSRDKSKKKAEETMAKVQKLKEENKKL
ESKIDEQKKTKKFLKDLFLQQTTSKIQNPTSEQLTLINEENSEDDIESEFSTQSSVEESS
SSSEEEPTSKSKRTKK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g8914.t1 | Coils | Coil | Coil | 36 | 77 | - |
| 5 | g8914.t1 | Gene3D | G3DSA:1.20.5.170 | - | 5 | 83 | 8.9E-18 |
| 8 | g8914.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 67 | - |
| 9 | g8914.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 81 | 97 | - |
| 10 | g8914.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 81 | 136 | - |
| 2 | g8914.t1 | PANTHER | PTHR23334:SF20 | CCAAT/ENHANCER-BINDING PROTEIN-RELATED | 5 | 84 | 2.7E-17 |
| 3 | g8914.t1 | PANTHER | PTHR23334 | CCAAT/ENHANCER BINDING PROTEIN | 5 | 84 | 2.7E-17 |
| 1 | g8914.t1 | Pfam | PF07716 | Basic region leucine zipper | 18 | 69 | 1.2E-13 |
| 11 | g8914.t1 | ProSiteProfiles | PS50217 | Basic-leucine zipper (bZIP) domain profile. | 18 | 81 | 10.151 |
| 7 | g8914.t1 | SMART | SM00338 | brlzneu | 16 | 80 | 1.4E-6 |
| 4 | g8914.t1 | SUPERFAMILY | SSF57959 | Leucine zipper domain | 15 | 80 | 1.55E-17 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006355 | regulation of transcription, DNA-templated | BP |
| GO:0003700 | DNA-binding transcription factor activity | MF |
KEGG
Orthology
- This transcript has been annotated with K10049 (CCAAT/enhancer binding protein (C/EBP), gamma)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
