Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative Lysophospholipid acyltransferase 2.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g8921 g8921.t5 TSS g8921.t5 33813080 33813080
chr_2 g8921 g8921.t5 isoform g8921.t5 33813254 33817123
chr_2 g8921 g8921.t5 exon g8921.t5.exon1 33813254 33813355
chr_2 g8921 g8921.t5 cds g8921.t5.CDS1 33813254 33813355
chr_2 g8921 g8921.t5 exon g8921.t5.exon2 33816675 33816898
chr_2 g8921 g8921.t5 cds g8921.t5.CDS2 33816675 33816898
chr_2 g8921 g8921.t5 exon g8921.t5.exon3 33816958 33817123
chr_2 g8921 g8921.t5 cds g8921.t5.CDS3 33816958 33817123
chr_2 g8921 g8921.t5 TTS g8921.t5 NA NA

Sequences

>g8921.t5 Gene=g8921 Length=492
ATGACAAATAAATTGGATATTGAGATTGGAGAGGAATCGGGTTACGAAGGAAGCAAAGTT
TTTGTATCACTGGCTGATGCAATTGGACTATCAGTGGATTTGACAAACTTTTTGATCACA
CAAGGACTTGCATTACTTTTGGCTTCATTATTTCGATCTTATTTGCATCCATCGAAAGTA
ACAGCCAGTGTTCGTCATGCCTTTGGTTTAGTAATTGGCTTATTGTTTGGCTATTTTTGC
TTTGGTTTACAAGCAGTTCATATTGCTGGTTTACCTGCAATATGCTACATTGTATTACGC
ACTCAAAATCCAATGATTGTTCAAAGAATTGTCATGGCTGTTGCACTCACTTATTTGTCA
TGTATTCACTTGCATCGACAATATAATAGCAACGGAGCATATACGTTAGATATCACTGGT
CCATTAATGATTATTACTCAAAAAGTCACGAGTTTAGCGTTTAGCATTCATGATGGATTT
TTATTAAAAAAA

>g8921.t5 Gene=g8921 Length=164
MTNKLDIEIGEESGYEGSKVFVSLADAIGLSVDLTNFLITQGLALLLASLFRSYLHPSKV
TASVRHAFGLVIGLLFGYFCFGLQAVHIAGLPAICYIVLRTQNPMIVQRIVMAVALTYLS
CIHLHRQYNSNGAYTLDITGPLMIITQKVTSLAFSIHDGFLLKK

Protein features from InterProScan

Transcript Database ID Name Start End E.value
1 g8921.t5 PANTHER PTHR13906 PORCUPINE 15 161 1.4E-37
7 g8921.t5 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 1 33 -
11 g8921.t5 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 34 55 -
5 g8921.t5 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 56 66 -
10 g8921.t5 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 67 99 -
8 g8921.t5 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 100 104 -
9 g8921.t5 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 105 124 -
6 g8921.t5 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 125 164 -
4 g8921.t5 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 37 55 -
2 g8921.t5 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 68 90 -
3 g8921.t5 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 105 124 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values