Gene loci information

Transcript annotation

  • This transcript has been not been annotated.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g8936 g8936.t1 TTS g8936.t1 33942887 33942887
chr_2 g8936 g8936.t1 isoform g8936.t1 33943088 33943384
chr_2 g8936 g8936.t1 exon g8936.t1.exon1 33943088 33943384
chr_2 g8936 g8936.t1 cds g8936.t1.CDS1 33943088 33943384
chr_2 g8936 g8936.t1 TSS g8936.t1 NA NA

Sequences

>g8936.t1 Gene=g8936 Length=297
ATGACGTCTACAGCTAAAGTAGCTAGATGGTTTAATCAACTTCAAGCATATCCTGCTGCA
TCGCTATCGCGTCCCGAAAGTGGTTTCGTATCGACTTCAGAGTCTCGTGCATCCGAGAAA
AATCTAAAGAAGTCGGAAATCGATGATCACGATGGTAAAAATTTATTTCCAATCAACGAT
GAATTCGCAGACGAATATCTTTTAGTCGAAGGCACTGCGTCTTTATGGAGTAAACTCAGT
GTTAAAAAACGAAAAAAACTTTTAGGATTAAAACTTGGAAAAGTAACTACATTTTAA

>g8936.t1 Gene=g8936 Length=98
MTSTAKVARWFNQLQAYPAASLSRPESGFVSTSESRASEKNLKKSEIDDHDGKNLFPIND
EFADEYLLVEGTASLWSKLSVKKRKKLLGLKLGKVTTF

Protein features from InterProScan

Transcript Database ID Name Start End E.value
g8936.t1 MobiDBLite mobidb-lite consensus disorder prediction 22 44 -
g8936.t1 MobiDBLite mobidb-lite consensus disorder prediction 22 36 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values