Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative Dynactin subunit 5.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g8970 g8970.t2 TSS g8970.t2 34263312 34263312
chr_2 g8970 g8970.t2 isoform g8970.t2 34263387 34263854
chr_2 g8970 g8970.t2 exon g8970.t2.exon1 34263387 34263449
chr_2 g8970 g8970.t2 cds g8970.t2.CDS1 34263387 34263449
chr_2 g8970 g8970.t2 exon g8970.t2.exon2 34263504 34263552
chr_2 g8970 g8970.t2 cds g8970.t2.CDS2 34263504 34263552
chr_2 g8970 g8970.t2 exon g8970.t2.exon3 34263618 34263854
chr_2 g8970 g8970.t2 cds g8970.t2.CDS3 34263618 34263853
chr_2 g8970 g8970.t2 TTS g8970.t2 NA NA

Sequences

>g8970.t2 Gene=g8970 Length=349
ATGGAAATTTGTGACATGTATTATAATAAAGATGAGTTTGTAGAAACTGCATCAGGAAAT
AAAGTAAATCGACAAACTGTATTGTGTGGAAGTCAAAATATTGTATTGCATGGTAAAGTA
ATAGTTGATAAGGGAGCAATAATTCGTGGAGATCTGGCAAATGTGAGAACTGGAAGGTAT
TGTGTGATTTCAAAAAATGCAGTAGTTAGACCACCATTTAAACAATTTAGCAAAGGAGTT
GCTTTCTTCCCTCTTCATATTGGAGATCATGTTTATATTGGTGAAAATTCTGTTGTGAGT
GCTGCAAGTATTGGATCTTATGTTTATATAGGCAAAAATGTTGTGATTG

>g8970.t2 Gene=g8970 Length=116
MEICDMYYNKDEFVETASGNKVNRQTVLCGSQNIVLHGKVIVDKGAIIRGDLANVRTGRY
CVISKNAVVRPPFKQFSKGVAFFPLHIGDHVYIGENSVVSAASIGSYVYIGKNVVI

Protein features from InterProScan

Transcript Database ID Name Start End E.value
5 g8970.t2 CDD cd03359 LbH_Dynactin_5 13 116 0.0e+00
4 g8970.t2 Gene3D G3DSA:2.160.10.10 Hexapeptide repeat proteins 18 116 0.0e+00
2 g8970.t2 PANTHER PTHR46126 DYNACTIN SUBUNIT 5 1 116 0.0e+00
1 g8970.t2 Pfam PF00132 Bacterial transferase hexapeptide (six repeats) 85 116 2.1e-05
3 g8970.t2 SUPERFAMILY SSF51161 Trimeric LpxA-like enzymes 8 116 0.0e+00

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values