| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g9066 | g9066.t18 | TTS | g9066.t18 | 35013961 | 35013961 |
| chr_2 | g9066 | g9066.t18 | isoform | g9066.t18 | 35014027 | 35015255 |
| chr_2 | g9066 | g9066.t18 | exon | g9066.t18.exon1 | 35014027 | 35014095 |
| chr_2 | g9066 | g9066.t18 | cds | g9066.t18.CDS1 | 35014027 | 35014095 |
| chr_2 | g9066 | g9066.t18 | exon | g9066.t18.exon2 | 35014288 | 35014474 |
| chr_2 | g9066 | g9066.t18 | cds | g9066.t18.CDS2 | 35014288 | 35014474 |
| chr_2 | g9066 | g9066.t18 | exon | g9066.t18.exon3 | 35014695 | 35014854 |
| chr_2 | g9066 | g9066.t18 | cds | g9066.t18.CDS3 | 35014695 | 35014854 |
| chr_2 | g9066 | g9066.t18 | exon | g9066.t18.exon4 | 35015252 | 35015255 |
| chr_2 | g9066 | g9066.t18 | cds | g9066.t18.CDS4 | 35015252 | 35015255 |
| chr_2 | g9066 | g9066.t18 | TSS | g9066.t18 | 35015280 | 35015280 |
>g9066.t18 Gene=g9066 Length=420
ATGGGAAAACCAAGAGGAATTCGAACTGCTCGTAAGCTTAAAACACACAGACGTGACCAA
CGATGGGCTGACAAAGATTATAAGAAAGCTCACTTGGGTACTCGCTGGAAGGCAAATCCA
TTTGGAGGTGCATCTCATGCTAAGGGAATCGTTCTTGAAAAAGTTGGTGTTGAAGCTAAA
CAGCCAAACTCAGCTATCCGCAAGTGCGTTCGTGTACAATTGATCAAGAATGGCAAGAAA
ATTACCGCTTTCGTTCCTCGTGATGGTTGCTTAAACTATATTGAAGAAAATGACGAAGTT
TTGGTTGCAGGTTTTGGTCGTAAAGGTCACGCTGTTGGTGATATTCCCGGAGTCGTCAAA
GTAGCAAATGTTTCGCTATTGGCCTTATACAAGGAAAAGAAAGAGCGACCACGTTCATAA
>g9066.t18 Gene=g9066 Length=139
MGKPRGIRTARKLKTHRRDQRWADKDYKKAHLGTRWKANPFGGASHAKGIVLEKVGVEAK
QPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGRKGHAVGDIPGVVK
VANVSLLALYKEKKERPRS
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g9066.t18 | CDD | cd03367 | Ribosomal_S23 | 26 | 136 | 1.68477E-75 |
| 5 | g9066.t18 | Gene3D | G3DSA:2.40.50.140 | - | 25 | 139 | 1.1E-62 |
| 9 | g9066.t18 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 16 | - |
| 10 | g9066.t18 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 26 | - |
| 2 | g9066.t18 | PANTHER | PTHR11652:SF14 | 40S RIBOSOMAL PROTEIN S23 | 1 | 139 | 1.5E-79 |
| 3 | g9066.t18 | PANTHER | PTHR11652 | 30S RIBOSOMAL PROTEIN S12 FAMILY MEMBER | 1 | 139 | 1.5E-79 |
| 6 | g9066.t18 | PIRSF | PIRSF002133 | RPS12p_RPS12a_RPS23e_RPS12o | 16 | 139 | 4.2E-30 |
| 1 | g9066.t18 | Pfam | PF00164 | Ribosomal protein S12/S23 | 30 | 138 | 7.4E-46 |
| 8 | g9066.t18 | ProSitePatterns | PS00055 | Ribosomal protein S12 signature. | 60 | 67 | - |
| 4 | g9066.t18 | SUPERFAMILY | SSF50249 | Nucleic acid-binding proteins | 20 | 137 | 8.57E-32 |
| 11 | g9066.t18 | TIGRFAM | TIGR00982 | uS12_E_A: ribosomal protein uS12 | 7 | 138 | 5.5E-51 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005840 | ribosome | CC |
| GO:0006412 | translation | BP |
| GO:0003735 | structural constituent of ribosome | MF |
| GO:0015935 | small ribosomal subunit | CC |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.