| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g9066 | g9066.t19 | TTS | g9066.t19 | 35013961 | 35013961 |
| chr_2 | g9066 | g9066.t19 | isoform | g9066.t19 | 35014027 | 35015255 |
| chr_2 | g9066 | g9066.t19 | exon | g9066.t19.exon1 | 35014027 | 35014095 |
| chr_2 | g9066 | g9066.t19 | cds | g9066.t19.CDS1 | 35014027 | 35014095 |
| chr_2 | g9066 | g9066.t19 | exon | g9066.t19.exon2 | 35014276 | 35014474 |
| chr_2 | g9066 | g9066.t19 | cds | g9066.t19.CDS2 | 35014276 | 35014474 |
| chr_2 | g9066 | g9066.t19 | exon | g9066.t19.exon3 | 35014695 | 35014854 |
| chr_2 | g9066 | g9066.t19 | cds | g9066.t19.CDS3 | 35014695 | 35014854 |
| chr_2 | g9066 | g9066.t19 | exon | g9066.t19.exon4 | 35015248 | 35015255 |
| chr_2 | g9066 | g9066.t19 | cds | g9066.t19.CDS4 | 35015248 | 35015254 |
| chr_2 | g9066 | g9066.t19 | TSS | g9066.t19 | 35015280 | 35015280 |
>g9066.t19 Gene=g9066 Length=436
ATGGGTGCGAAAACCAAGAGGAATTCGAACTGCTCGTAAGCTTAAAACACACAGACGTGA
CCAACGATGGGCTGACAAAGATTATAAGAAAGCTCACTTGGGTACTCGCTGGAAGGCAAA
TCCATTTGGAGGTGCATCTCATGCTAAGGGAATCGTTCTTGAAAAAGTTGGTGTTGAAGC
TAAACAGCCAAACTCAGCTATCCGCAAGTGCGTTCGTGTACAATTGATCAAGAATGGCAA
GAAAATTACCGCTTTCGTTCCTCGTGATGGTTGCTTAAACTATATTGAAGAAAATGACGA
AGTTTTGGTTGCAGGTTTTGGTCGTAAAGGTCACGCTGTTGGTGATATTCCCGGAGTAAG
ATTTAAGGTCGTCAAAGTAGCAAATGTTTCGCTATTGGCCTTATACAAGGAAAAGAAAGA
GCGACCACGTTCATAA
>g9066.t19 Gene=g9066 Length=144
WVRKPRGIRTARKLKTHRRDQRWADKDYKKAHLGTRWKANPFGGASHAKGIVLEKVGVEA
KQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGRKGHAVGDIPGVR
FKVVKVANVSLLALYKEKKERPRS
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g9066.t19 | CDD | cd03367 | Ribosomal_S23 | 27 | 141 | 4.91103E-81 |
| 5 | g9066.t19 | Gene3D | G3DSA:2.40.50.140 | - | 26 | 144 | 3.8E-69 |
| 9 | g9066.t19 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 21 | - |
| 10 | g9066.t19 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 17 | - |
| 2 | g9066.t19 | PANTHER | PTHR11652:SF14 | 40S RIBOSOMAL PROTEIN S23 | 3 | 144 | 1.3E-84 |
| 3 | g9066.t19 | PANTHER | PTHR11652 | 30S RIBOSOMAL PROTEIN S12 FAMILY MEMBER | 3 | 144 | 1.3E-84 |
| 6 | g9066.t19 | PIRSF | PIRSF002133 | RPS12p_RPS12a_RPS23e_RPS12o | 17 | 144 | 2.6E-35 |
| 1 | g9066.t19 | Pfam | PF00164 | Ribosomal protein S12/S23 | 31 | 143 | 5.2E-52 |
| 8 | g9066.t19 | ProSitePatterns | PS00055 | Ribosomal protein S12 signature. | 61 | 68 | - |
| 4 | g9066.t19 | SUPERFAMILY | SSF50249 | Nucleic acid-binding proteins | 21 | 142 | 1.8E-36 |
| 11 | g9066.t19 | TIGRFAM | TIGR00982 | uS12_E_A: ribosomal protein uS12 | 8 | 143 | 1.2E-56 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005840 | ribosome | CC |
| GO:0006412 | translation | BP |
| GO:0003735 | structural constituent of ribosome | MF |
| GO:0015935 | small ribosomal subunit | CC |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.