| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g9066 | g9066.t28 | TTS | g9066.t28 | 35013961 | 35013961 |
| chr_2 | g9066 | g9066.t28 | isoform | g9066.t28 | 35014027 | 35015255 |
| chr_2 | g9066 | g9066.t28 | exon | g9066.t28.exon1 | 35014027 | 35014133 |
| chr_2 | g9066 | g9066.t28 | cds | g9066.t28.CDS1 | 35014083 | 35014133 |
| chr_2 | g9066 | g9066.t28 | exon | g9066.t28.exon2 | 35014342 | 35014474 |
| chr_2 | g9066 | g9066.t28 | cds | g9066.t28.CDS2 | 35014342 | 35014474 |
| chr_2 | g9066 | g9066.t28 | exon | g9066.t28.exon3 | 35014697 | 35014854 |
| chr_2 | g9066 | g9066.t28 | cds | g9066.t28.CDS3 | 35014697 | 35014722 |
| chr_2 | g9066 | g9066.t28 | exon | g9066.t28.exon4 | 35015252 | 35015255 |
| chr_2 | g9066 | g9066.t28 | TSS | g9066.t28 | 35015280 | 35015280 |
>g9066.t28 Gene=g9066 Length=402
ATGGGAAAACCAAGAGGAATTCGAACTGCTCGTAAGCTTAAAACACACAGACGTGACCAA
CGATGGGCTGACAAAGATTATAAGAAAGCTCACTTGGGTACTCGCTGGAAGGCAAATCCA
TTTGGAGGTGCATCTCATGCTAAGGGAATCGTTCTTGAAAAATGGTGTTGAAGCTAAACA
GCCAAACTCAGCTATCCGCAAGTGCGTTCGTGTACAATTGATCAAGAATGGCAAGAAAAT
TACCGCTTTCGTTCCTCGTGATGGTTGCTTAAACTATATTGAAGAAAATGACGAAAATTT
AACTAACGAATTTCATTTTTATTATCATTTTAGGTCGTCAAAGTAGCAAATGTTTCGCTA
TTGGCCTTATACAAGGAAAAGAAAGAGCGACCACGTTCATAA
>g9066.t28 Gene=g9066 Length=69
MLRESFLKNGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDENLTNEFH
FYYHFRSSK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g9066.t28 | Gene3D | G3DSA:2.40.50.140 | - | 3 | 67 | 5.9E-26 |
| 2 | g9066.t28 | PANTHER | PTHR11652:SF40 | 40S RIBOSOMAL PROTEIN S23-1-RELATED | 8 | 59 | 8.4E-26 |
| 3 | g9066.t28 | PANTHER | PTHR11652 | 30S RIBOSOMAL PROTEIN S12 FAMILY MEMBER | 8 | 59 | 8.4E-26 |
| 1 | g9066.t28 | Pfam | PF00164 | Ribosomal protein S12/S23 | 8 | 55 | 9.4E-22 |
| 5 | g9066.t28 | ProSitePatterns | PS00055 | Ribosomal protein S12 signature. | 14 | 21 | - |
| 4 | g9066.t28 | SUPERFAMILY | SSF50249 | Nucleic acid-binding proteins | 9 | 58 | 5.23E-14 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005840 | ribosome | CC |
| GO:0006412 | translation | BP |
| GO:0003735 | structural constituent of ribosome | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.