| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g9066 | g9066.t7 | TTS | g9066.t7 | 35013961 | 35013961 |
| chr_2 | g9066 | g9066.t7 | isoform | g9066.t7 | 35014027 | 35014852 |
| chr_2 | g9066 | g9066.t7 | exon | g9066.t7.exon1 | 35014027 | 35014095 |
| chr_2 | g9066 | g9066.t7 | cds | g9066.t7.CDS1 | 35014027 | 35014095 |
| chr_2 | g9066 | g9066.t7 | exon | g9066.t7.exon2 | 35014288 | 35014474 |
| chr_2 | g9066 | g9066.t7 | cds | g9066.t7.CDS2 | 35014288 | 35014474 |
| chr_2 | g9066 | g9066.t7 | exon | g9066.t7.exon3 | 35014697 | 35014852 |
| chr_2 | g9066 | g9066.t7 | cds | g9066.t7.CDS3 | 35014697 | 35014722 |
| chr_2 | g9066 | g9066.t7 | TSS | g9066.t7 | 35015280 | 35015280 |
>g9066.t7 Gene=g9066 Length=412
AAACCAAGAGGAATTCGAACTGCTCGTAAGCTTAAAACACACAGACGTGACCAACGATGG
GCTGACAAAGATTATAAGAAAGCTCACTTGGGTACTCGCTGGAAGGCAAATCCATTTGGA
GGTGCATCTCATGCTAAGGGAATCGTTCTTGAAAAATGGTGTTGAAGCTAAACAGCCAAA
CTCAGCTATCCGCAAGTGCGTTCGTGTACAATTGATCAAGAATGGCAAGAAAATTACCGC
TTTCGTTCCTCGTGATGGTTGCTTAAACTATATTGAAGAAAATGACGAAGTTTTGGTTGC
AGGTTTTGGTCGTAAAGGTCACGCTGTTGGTGATATTCCCGGAGTCGTCAAAGTAGCAAA
TGTTTCGCTATTGGCCTTATACAAGGAAAAGAAAGAGCGACCACGTTCATAA
>g9066.t7 Gene=g9066 Length=93
MLRESFLKNGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFG
RKGHAVGDIPGVVKVANVSLLALYKEKKERPRS
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g9066.t7 | Gene3D | G3DSA:2.40.50.140 | - | 3 | 93 | 5.0E-46 |
| 2 | g9066.t7 | PANTHER | PTHR11652:SF59 | BNACNNG03140D PROTEIN | 8 | 93 | 7.1E-48 |
| 3 | g9066.t7 | PANTHER | PTHR11652 | 30S RIBOSOMAL PROTEIN S12 FAMILY MEMBER | 8 | 93 | 7.1E-48 |
| 7 | g9066.t7 | PIRSF | PIRSF002133 | RPS12p_RPS12a_RPS23e_RPS12o | 6 | 93 | 9.4E-21 |
| 1 | g9066.t7 | Pfam | PF00164 | Ribosomal protein S12/S23 | 8 | 92 | 1.3E-36 |
| 5 | g9066.t7 | ProSitePatterns | PS00055 | Ribosomal protein S12 signature. | 14 | 21 | - |
| 4 | g9066.t7 | SUPERFAMILY | SSF50249 | Nucleic acid-binding proteins | 9 | 91 | 3.68E-21 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005840 | ribosome | CC |
| GO:0006412 | translation | BP |
| GO:0003735 | structural constituent of ribosome | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed