| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g9066 | g9066.t9 | TTS | g9066.t9 | 35013961 | 35013961 |
| chr_2 | g9066 | g9066.t9 | isoform | g9066.t9 | 35014027 | 35014855 |
| chr_2 | g9066 | g9066.t9 | exon | g9066.t9.exon1 | 35014027 | 35014095 |
| chr_2 | g9066 | g9066.t9 | cds | g9066.t9.CDS1 | 35014028 | 35014095 |
| chr_2 | g9066 | g9066.t9 | exon | g9066.t9.exon2 | 35014302 | 35014474 |
| chr_2 | g9066 | g9066.t9 | cds | g9066.t9.CDS2 | 35014302 | 35014474 |
| chr_2 | g9066 | g9066.t9 | exon | g9066.t9.exon3 | 35014695 | 35014855 |
| chr_2 | g9066 | g9066.t9 | cds | g9066.t9.CDS3 | 35014695 | 35014855 |
| chr_2 | g9066 | g9066.t9 | TSS | g9066.t9 | 35015280 | 35015280 |
>g9066.t9 Gene=g9066 Length=403
GGAAAACCAAGAGGAATTCGAACTGCTCGTAAGCTTAAAACACACAGACGTGACCAACGA
TGGGCTGACAAAGATTATAAGAAAGCTCACTTGGGTACTCGCTGGAAGGCAAATCCATTT
GGAGGTGCATCTCATGCTAAGGGAATCGTTCTTGAAAAAGTTGGTGTTGAAGCTAAACAG
CCAAACTCAGCTATCCGCAAGTGCGTTCGTGTACAATTGATCAAGAATGGCAAGAAAATT
ACCGCTTTCGTTCCTCGTGATGGTTGCTTAAACTATATTGAAGAAAATGACGAAGTTTTG
GTTGCAGGTTTTGGTCGTAAAGGTCACGCTGTTGGTCGTCAAAGTAGCAAATGTTTCGCT
ATTGGCCTTATACAAGGAAAAGAAAGAGCGACCACGTTCATAA
>g9066.t9 Gene=g9066 Length=134
GKPRGIRTARKLKTHRRDQRWADKDYKKAHLGTRWKANPFGGASHAKGIVLEKVGVEAKQ
PNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGRKGHAVGRQSSKCFA
IGLIQGKERATTFI
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g9066.t9 | Gene3D | G3DSA:2.40.50.140 | - | 24 | 126 | 1.5E-50 |
| 6 | g9066.t9 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 25 | - |
| 7 | g9066.t9 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 15 | - |
| 2 | g9066.t9 | PANTHER | PTHR11652:SF14 | 40S RIBOSOMAL PROTEIN S23 | 1 | 123 | 1.4E-67 |
| 3 | g9066.t9 | PANTHER | PTHR11652 | 30S RIBOSOMAL PROTEIN S12 FAMILY MEMBER | 1 | 123 | 1.4E-67 |
| 1 | g9066.t9 | Pfam | PF00164 | Ribosomal protein S12/S23 | 29 | 114 | 5.8E-38 |
| 5 | g9066.t9 | ProSitePatterns | PS00055 | Ribosomal protein S12 signature. | 59 | 66 | - |
| 4 | g9066.t9 | SUPERFAMILY | SSF50249 | Nucleic acid-binding proteins | 19 | 107 | 1.29E-27 |
| 9 | g9066.t9 | TIGRFAM | TIGR00982 | uS12_E_A: ribosomal protein uS12 | 6 | 113 | 5.9E-43 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005840 | ribosome | CC |
| GO:0006412 | translation | BP |
| GO:0003735 | structural constituent of ribosome | MF |
| GO:0015935 | small ribosomal subunit | CC |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed