Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g9086 g9086.t3 TTS g9086.t3 35200031 35200031
chr_2 g9086 g9086.t3 isoform g9086.t3 35200065 35200406
chr_2 g9086 g9086.t3 exon g9086.t3.exon1 35200065 35200406
chr_2 g9086 g9086.t3 cds g9086.t3.CDS1 35200065 35200406
chr_2 g9086 g9086.t3 TSS g9086.t3 35201429 35201429

Sequences

>g9086.t3 Gene=g9086 Length=342
ATGTTTCAATTACAAGTTGAATTTTGTTTAACGTTTATGACAAAAAGAAAGAAATTACCA
TCAAAAGAACAAATGTTAGAAGAATATGAATTAGACATGCTTGAGCGTTGGAAAAAAGGA
TTATCGAAAAGAAAAGGACATTTTCTCGGTCATAAAGCTGAAGCACAAAAGAAATACTAT
GATGAACTTGCGAAAAAGGCAAATATTGAAGGAATTAAATCTTGTATTGTCAAAATACAT
TCTCATGCACACCTCAATAGATCGAAACATTTTACAAATTACAGAAATGTCAAATACACT
ATCATCGATGAGAACAATTTCATTGTTAGTCCATTACAATAA

>g9086.t3 Gene=g9086 Length=113
MFQLQVEFCLTFMTKRKKLPSKEQMLEEYELDMLERWKKGLSKRKGHFLGHKAEAQKKYY
DELAKKANIEGIKSCIVKIHSHAHLNRSKHFTNYRNVKYTIIDENNFIVSPLQ

Protein features from InterProScan

Transcript Database ID Name Start End E.value
2 g9086.t3 Coils Coil Coil 112 113 -
1 g9086.t3 Gene3D G3DSA:3.50.50.60 - 1 112 7.6E-15

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed