General information for g910.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g910 is located on chr_3: 6809207..6812083 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g910 | g910.t1 | isoform | g910.t1 | 6809207 | 6812083 |
| chr_3 | g910 | g910.t1 | exon | g910.t1.exon1 | 6809207 | 6809417 |
| chr_3 | g910 | g910.t1 | cds | g910.t1.CDS1 | 6809207 | 6809417 |
| chr_3 | g910 | g910.t1 | exon | g910.t1.exon2 | 6811920 | 6812083 |
| chr_3 | g910 | g910.t1 | cds | g910.t1.CDS2 | 6811920 | 6812083 |
| chr_3 | g910 | g910.t1 | TSS | g910.t1 | NA | NA |
| chr_3 | g910 | g910.t1 | TTS | g910.t1 | NA | NA |
Sequences
>g910.t1 Gene=g910 Length=375
ATGCTTCAATATCACACTGATGCAGACTCAATGAATTTAGTAGACATTTCAGTGGACACT
TTTCGAATAATTCTCGATTTTATCTATACTGATAAGCTTCCAAATGAGCCTGATATCGAT
TACACTCGAATTTTTACGTCTGCATCGAAGCTGAAAATTGAAAAGTCACCTTCAGAACAT
TCTGGTCGTAAGGGCTGCTGTGGCCAATTTTTTCATAGTCCAAAATCATTGGGATTAATA
GCAATGATTGCTTTAGGCGGGGTAGCGTGTGCTCTAGGTGGAGCGGCATGGGGTGCTAGT
GGTCTTGCTGGTCAGCCATCAACTCATCTCACAGTCTCGCTACTGATGATTGGTAAGAAC
AACGACAATAAGTAA
>g910.t1 Gene=g910 Length=124
MLQYHTDADSMNLVDISVDTFRIILDFIYTDKLPNEPDIDYTRIFTSASKLKIEKSPSEH
SGRKGCCGQFFHSPKSLGLIAMIALGGVACALGGAAWGASGLAGQPSTHLTVSLLMIGKN
NDNK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g910.t1 | CDD | cd18186 | BTB_POZ_ZBTB_KLHL-like | 1 | 51 | 3.60251E-6 |
| 4 | g910.t1 | Gene3D | G3DSA:3.30.710.10 | Potassium Channel Kv1.1; Chain A | 3 | 77 | 2.9E-5 |
| 1 | g910.t1 | Pfam | PF00651 | BTB/POZ domain | 10 | 55 | 1.8E-5 |
| 5 | g910.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 78 | - |
| 7 | g910.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 79 | 99 | - |
| 6 | g910.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 100 | 124 | - |
| 3 | g910.t1 | SUPERFAMILY | SSF54695 | POZ domain | 4 | 54 | 5.5E-6 |
| 2 | g910.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 77 | 99 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005515 | protein binding | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed