Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_3 g910 g910.t1 isoform g910.t1 6809207 6812083
chr_3 g910 g910.t1 exon g910.t1.exon1 6809207 6809417
chr_3 g910 g910.t1 cds g910.t1.CDS1 6809207 6809417
chr_3 g910 g910.t1 exon g910.t1.exon2 6811920 6812083
chr_3 g910 g910.t1 cds g910.t1.CDS2 6811920 6812083
chr_3 g910 g910.t1 TSS g910.t1 NA NA
chr_3 g910 g910.t1 TTS g910.t1 NA NA

Sequences

>g910.t1 Gene=g910 Length=375
ATGCTTCAATATCACACTGATGCAGACTCAATGAATTTAGTAGACATTTCAGTGGACACT
TTTCGAATAATTCTCGATTTTATCTATACTGATAAGCTTCCAAATGAGCCTGATATCGAT
TACACTCGAATTTTTACGTCTGCATCGAAGCTGAAAATTGAAAAGTCACCTTCAGAACAT
TCTGGTCGTAAGGGCTGCTGTGGCCAATTTTTTCATAGTCCAAAATCATTGGGATTAATA
GCAATGATTGCTTTAGGCGGGGTAGCGTGTGCTCTAGGTGGAGCGGCATGGGGTGCTAGT
GGTCTTGCTGGTCAGCCATCAACTCATCTCACAGTCTCGCTACTGATGATTGGTAAGAAC
AACGACAATAAGTAA

>g910.t1 Gene=g910 Length=124
MLQYHTDADSMNLVDISVDTFRIILDFIYTDKLPNEPDIDYTRIFTSASKLKIEKSPSEH
SGRKGCCGQFFHSPKSLGLIAMIALGGVACALGGAAWGASGLAGQPSTHLTVSLLMIGKN
NDNK

Protein features from InterProScan

Transcript Database ID Name Start End E.value
8 g910.t1 CDD cd18186 BTB_POZ_ZBTB_KLHL-like 1 51 3.60251E-6
4 g910.t1 Gene3D G3DSA:3.30.710.10 Potassium Channel Kv1.1; Chain A 3 77 2.9E-5
1 g910.t1 Pfam PF00651 BTB/POZ domain 10 55 1.8E-5
5 g910.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 1 78 -
7 g910.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 79 99 -
6 g910.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 100 124 -
3 g910.t1 SUPERFAMILY SSF54695 POZ domain 4 54 5.5E-6
2 g910.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 77 99 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0005515 protein binding MF

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed