General information for g9140.t2
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Glutathione S-transferase D7.
Parent gene
- The parent gene g9140 is located on chr_1: 407977..408771 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g9140 | g9140.t2 | TSS | g9140.t2 | 407931 | 407931 |
| chr_1 | g9140 | g9140.t2 | isoform | g9140.t2 | 407977 | 408316 |
| chr_1 | g9140 | g9140.t2 | exon | g9140.t2.exon1 | 407977 | 408316 |
| chr_1 | g9140 | g9140.t2 | cds | g9140.t2.CDS1 | 407977 | 408315 |
| chr_1 | g9140 | g9140.t2 | TTS | g9140.t2 | 408830 | 408830 |
Sequences
>g9140.t2 Gene=g9140 Length=340
ATGGCTCCAATTATTTTATATCATTCACCAGCTTCGCCTTTCTCAAGGTCTGTACTTCTT
CTTATGAGATATTTGAAATTAGATGTCGAGGTCAAGGTTATGAATTTGATGGAAAAAGAA
CAGTTCACGCCAGAATTTCTCAAAATCAATCCACAACATTGTGTACCAACAATCGATGAT
GATGGATTTTACTTGTGGGAATCGAGAGCTATTTTGGCTTATTTGCTCGAATCGAAAGCA
CCCGAACTCGTGCCAACATCACCAAAAGAAAAAGCAATTGTAAATCAACGTCTTCATTAT
GAGTTAGGCGGATTCACTAATAAATTTATTCAGCTTGTGG
>g9140.t2 Gene=g9140 Length=113
MAPIILYHSPASPFSRSVLLLMRYLKLDVEVKVMNLMEKEQFTPEFLKINPQHCVPTIDD
DGFYLWESRAILAYLLESKAPELVPTSPKEKAIVNQRLHYELGGFTNKFIQLV
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g9140.t2 | CDD | cd03045 | GST_N_Delta_Epsilon | 4 | 77 | 0.000 |
| 5 | g9140.t2 | Gene3D | G3DSA:1.20.1050.130 | - | 1 | 113 | 0.000 |
| 2 | g9140.t2 | PANTHER | PTHR43969:SF9 | GLUTATHIONE S TRANSFERASE D10, ISOFORM A-RELATED | 1 | 111 | 0.000 |
| 3 | g9140.t2 | PANTHER | PTHR43969 | GLUTATHIONE S TRANSFERASE D10, ISOFORM A-RELATED | 1 | 111 | 0.000 |
| 1 | g9140.t2 | Pfam | PF13417 | Glutathione S-transferase, N-terminal domain | 6 | 78 | 0.000 |
| 6 | g9140.t2 | ProSiteProfiles | PS50404 | Soluble glutathione S-transferase N-terminal domain profile. | 2 | 83 | 19.859 |
| 8 | g9140.t2 | SFLD | SFLDG00358 | Main (cytGST) | 5 | 112 | 0.000 |
| 9 | g9140.t2 | SFLD | SFLDS00019 | Glutathione Transferase (cytosolic) | 5 | 112 | 0.000 |
| 4 | g9140.t2 | SUPERFAMILY | SSF52833 | Thioredoxin-like | 1 | 79 | 0.000 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006749 | glutathione metabolic process | BP |
| GO:0005515 | protein binding | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed