General information for g9156.t8
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Ubiquitin-conjugating enzyme E2 G1.
Parent gene
- The parent gene g9156 is located on chr_1: 528625..530131 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g9156 | g9156.t8 | TTS | g9156.t8 | 528549 | 528549 |
| chr_1 | g9156 | g9156.t8 | isoform | g9156.t8 | 528625 | 529018 |
| chr_1 | g9156 | g9156.t8 | exon | g9156.t8.exon1 | 528625 | 528860 |
| chr_1 | g9156 | g9156.t8 | cds | g9156.t8.CDS1 | 528625 | 528860 |
| chr_1 | g9156 | g9156.t8 | exon | g9156.t8.exon2 | 528921 | 529018 |
| chr_1 | g9156 | g9156.t8 | cds | g9156.t8.CDS2 | 528921 | 528972 |
| chr_1 | g9156 | g9156.t8 | TSS | g9156.t8 | 529971 | 529971 |
Sequences
>g9156.t8 Gene=g9156 Length=334
AGCTCATCTTTACTTCCCTAAAGAATATCCACTAAGACCTCCTCGCATGCGTTTTGTTAC
AGAAATTTGGCATCCAAATATTGATCAAAATGGAGATGTCTGCATTAGTATCTTGCATGA
ACCTGGTGATGACAAATGGGGATATGAAAAAGCTTCAGAACGTTGGCTTCCGGTACACAC
AGTTGAGACAATTATTATTTCAGTTATTTCAATGTTAGCCGAACCGAATGATGAGTCACC
TGCTAATGTAGATGCAGCAAAGCAATGGCGAGAAGCTTATCCGGAATTTAAGCGAAGAGT
AGCTCGTTGTGTCCGTAAAAGTCAAGAGGAGTAA
>g9156.t8 Gene=g9156 Length=95
MRFVTEIWHPNIDQNGDVCISILHEPGDDKWGYEKASERWLPVHTVETIIISVISMLAEP
NDESPANVDAAKQWREAYPEFKRRVARCVRKSQEE
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g9156.t8 | CDD | cd00195 | UBCc | 1 | 89 | 2.02288E-33 |
| 5 | g9156.t8 | Gene3D | G3DSA:3.10.110.10 | Ubiquitin Conjugating Enzyme | 1 | 95 | 8.3E-39 |
| 2 | g9156.t8 | PANTHER | PTHR24067:SF258 | UBIQUITIN-CONJUGATING ENZYME E2G 1A (UBC7 HOMOLOG, YEAST) | 1 | 94 | 1.0E-45 |
| 3 | g9156.t8 | PANTHER | PTHR24067 | UBIQUITIN-CONJUGATING ENZYME E2 | 1 | 94 | 1.0E-45 |
| 1 | g9156.t8 | Pfam | PF00179 | Ubiquitin-conjugating enzyme | 1 | 88 | 1.2E-25 |
| 7 | g9156.t8 | ProSitePatterns | PS00183 | Ubiquitin-conjugating enzymes active site. | 8 | 23 | - |
| 9 | g9156.t8 | ProSiteProfiles | PS50127 | Ubiquitin-conjugating enzymes family profile. | 1 | 83 | 21.545 |
| 8 | g9156.t8 | SMART | SM00212 | ubc_7 | 1 | 94 | 7.4E-9 |
| 4 | g9156.t8 | SUPERFAMILY | SSF54495 | UBC-like | 1 | 92 | 6.81E-30 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K10575 (ubiquitin-conjugating enzyme E2 G1)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
