| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g9156 | g9156.t9 | TTS | g9156.t9 | 528549 | 528549 |
| chr_1 | g9156 | g9156.t9 | isoform | g9156.t9 | 528625 | 529565 |
| chr_1 | g9156 | g9156.t9 | exon | g9156.t9.exon1 | 528625 | 528860 |
| chr_1 | g9156 | g9156.t9 | cds | g9156.t9.CDS1 | 528625 | 528860 |
| chr_1 | g9156 | g9156.t9 | exon | g9156.t9.exon2 | 528921 | 529042 |
| chr_1 | g9156 | g9156.t9 | cds | g9156.t9.CDS2 | 528921 | 529042 |
| chr_1 | g9156 | g9156.t9 | exon | g9156.t9.exon3 | 529297 | 529365 |
| chr_1 | g9156 | g9156.t9 | cds | g9156.t9.CDS3 | 529297 | 529325 |
| chr_1 | g9156 | g9156.t9 | exon | g9156.t9.exon4 | 529499 | 529565 |
| chr_1 | g9156 | g9156.t9 | TSS | g9156.t9 | 529971 | 529971 |
>g9156.t9 Gene=g9156 Length=494
ATGGACACAACTGCATCACTTCTTTTAAAAAAGCAATTAGCAGAGCTCAATAAGCACCCA
GTAGAAGGTTTCTCGGCAGGACTTGTTGATGACAATGATATTTTCAAATGGGAAGTGCTG
ATAATTGGTCCTCCAGATGTATTGATTGTCATCTTATTACAGCTCATCTTTACTTCCCTA
AAGAATATCCACTAAGACCTCCTCGCATGCGTTTTGTTACAGAAATTTGGCATCCAAATA
TTGATCAAAATGGAGATGTCTGCATTAGTATCTTGCATGAACCTGGTGATGACAAATGGG
GATATGAAAAAGCTTCAGAACGTTGGCTTCCGGTACACACAGTTGAGACAATTATTATTT
CAGTTATTTCAATGTTAGCCGAACCGAATGATGAGTCACCTGCTAATGTAGATGCAGCAA
AGCAATGGCGAGAAGCTTATCCGGAATTTAAGCGAAGAGTAGCTCGTTGTGTCCGTAAAA
GTCAAGAGGAGTAA
>g9156.t9 Gene=g9156 Length=128
MGSADNWSSRCIDCHLITAHLYFPKEYPLRPPRMRFVTEIWHPNIDQNGDVCISILHEPG
DDKWGYEKASERWLPVHTVETIIISVISMLAEPNDESPANVDAAKQWREAYPEFKRRVAR
CVRKSQEE
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g9156.t9 | CDD | cd00195 | UBCc | 16 | 122 | 3.39518E-41 |
| 5 | g9156.t9 | Gene3D | G3DSA:3.10.110.10 | Ubiquitin Conjugating Enzyme | 14 | 128 | 2.8E-47 |
| 2 | g9156.t9 | PANTHER | PTHR24067:SF258 | UBIQUITIN-CONJUGATING ENZYME E2G 1A (UBC7 HOMOLOG, YEAST) | 16 | 127 | 1.9E-56 |
| 3 | g9156.t9 | PANTHER | PTHR24067 | UBIQUITIN-CONJUGATING ENZYME E2 | 16 | 127 | 1.9E-56 |
| 1 | g9156.t9 | Pfam | PF00179 | Ubiquitin-conjugating enzyme | 18 | 121 | 6.8E-34 |
| 7 | g9156.t9 | ProSitePatterns | PS00183 | Ubiquitin-conjugating enzymes active site. | 41 | 56 | - |
| 9 | g9156.t9 | ProSiteProfiles | PS50127 | Ubiquitin-conjugating enzymes family profile. | 21 | 116 | 27.342 |
| 8 | g9156.t9 | SMART | SM00212 | ubc_7 | 1 | 127 | 3.1E-29 |
| 4 | g9156.t9 | SUPERFAMILY | SSF54495 | UBC-like | 18 | 125 | 2.75E-38 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed