| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g9278 | g9278.t14 | TSS | g9278.t14 | 1398732 | 1398732 |
| chr_1 | g9278 | g9278.t14 | isoform | g9278.t14 | 1398759 | 1399725 |
| chr_1 | g9278 | g9278.t14 | exon | g9278.t14.exon1 | 1398759 | 1398792 |
| chr_1 | g9278 | g9278.t14 | exon | g9278.t14.exon2 | 1399162 | 1399345 |
| chr_1 | g9278 | g9278.t14 | cds | g9278.t14.CDS1 | 1399284 | 1399345 |
| chr_1 | g9278 | g9278.t14 | exon | g9278.t14.exon3 | 1399400 | 1399631 |
| chr_1 | g9278 | g9278.t14 | cds | g9278.t14.CDS2 | 1399400 | 1399631 |
| chr_1 | g9278 | g9278.t14 | exon | g9278.t14.exon4 | 1399687 | 1399725 |
| chr_1 | g9278 | g9278.t14 | cds | g9278.t14.CDS3 | 1399687 | 1399725 |
| chr_1 | g9278 | g9278.t14 | TTS | g9278.t14 | 1399800 | 1399800 |
>g9278.t14 Gene=g9278 Length=489
GAAGATATTCAAAGTAATTCAAAGTGAGTTTATACACATAAAGTGGCGATCTATGAACAT
CTCTTCAAAGAAGGAGTTCTTGTTGCACAAAAGGATTTTCATGCACCAAAACATCCCGAA
CTCGAGAGCGTTCCAAATCTTCATGTAATTAAGACTATGCAGTCATTGAAATCAAGAAAT
CTTGTTAAGGAACAATTTGCATGGAGACATTATTACTGGTATCTCACAAATGAAGGCATT
GAATATTTGCGTCAATATCTTCATTTGCCACCAGAAATCGTTCCATCAACATTGAAGCGA
ACAACTCGCTCAGATGCTGCTCGTCCTCGCGCTGCTCCACGTTCAGATGGACCAAAATCA
GGAGAAGATCGTCAAGCATACAGACGTGCACCAGGGCAATCGTCAGACAAAAAAGCCGAT
GTTGGTGCTGGTGCAGCTGATATTGAATTGCGTGGTGGATTCGGTCGTGGCTCAAGAGGC
CCACAGTAA
>g9278.t14 Gene=g9278 Length=110
MQSLKSRNLVKEQFAWRHYYWYLTNEGIEYLRQYLHLPPEIVPSTLKRTTRSDAARPRAA
PRSDGPKSGEDRQAYRRAPGQSSDKKADVGAGAADIELRGGFGRGSRGPQ
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 5 | g9278.t14 | Gene3D | G3DSA:1.10.10.10 | winged helix repressor DNA binding domain | 1 | 61 | 2.8E-27 |
| 4 | g9278.t14 | MobiDBLite | mobidb-lite | consensus disorder prediction | 41 | 110 | - |
| 3 | g9278.t14 | MobiDBLite | mobidb-lite | consensus disorder prediction | 51 | 83 | - |
| 2 | g9278.t14 | PANTHER | PTHR12146 | 40S RIBOSOMAL PROTEIN S10 | 1 | 106 | 5.8E-34 |
| 1 | g9278.t14 | Pfam | PF03501 | Plectin/S10 domain | 1 | 49 | 2.5E-25 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed