| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g9320 | g9320.t1 | isoform | g9320.t1 | 1837552 | 1840607 |
| chr_1 | g9320 | g9320.t1 | exon | g9320.t1.exon1 | 1837552 | 1837728 |
| chr_1 | g9320 | g9320.t1 | cds | g9320.t1.CDS1 | 1837552 | 1837728 |
| chr_1 | g9320 | g9320.t1 | exon | g9320.t1.exon2 | 1840344 | 1840607 |
| chr_1 | g9320 | g9320.t1 | cds | g9320.t1.CDS2 | 1840344 | 1840607 |
| chr_1 | g9320 | g9320.t1 | TSS | g9320.t1 | NA | NA |
| chr_1 | g9320 | g9320.t1 | TTS | g9320.t1 | NA | NA |
>g9320.t1 Gene=g9320 Length=441
ATGTTTGAAACAATCACTACAACCACAATATCATCTGCTCCAACATGGATCAGTTTATTG
AATGTGACCACAGCAATTGCAACAACATCGACTGCAATTTTCGATTCAAATCTTACAAAT
TTCGACACAAATGGAACCGATGATGGCAATGGGAGCATTTTCGATCTATGTGATGCTGAA
AATCCTGAATTTAATTGCACAGTAGATGAATATCTTAATCGTTATATGGGCTTAAAGCAA
ATGCCATTACATACTGCAATATGGGTTACAATCTTATATGTTGGAATTTTTGTCACAGGA
TTTATAGGAAATTTGATTGTGTGCGTTGTAATTGTGAAAAATGCTTCTATGCACACAGCT
ACAAATTATTATCTCTTCAGTCTTGCTGTATCGGATCTGATATTTTTGATGATGGGTAAG
TCTTTTTTTATTTATTACTGA
>g9320.t1 Gene=g9320 Length=146
MFETITTTTISSAPTWISLLNVTTAIATTSTAIFDSNLTNFDTNGTDDGNGSIFDLCDAE
NPEFNCTVDEYLNRYMGLKQMPLHTAIWVTILYVGIFVTGFIGNLIVCVVIVKNASMHTA
TNYYLFSLAVSDLIFLMMGKSFFIYY
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g9320.t1 | Gene3D | G3DSA:1.20.1070.10 | - | 66 | 146 | 1.7E-16 |
| 2 | g9320.t1 | PANTHER | PTHR24243:SF107 | NEUROPEPTIDES CAPA RECEPTOR | 58 | 139 | 2.2E-25 |
| 3 | g9320.t1 | PANTHER | PTHR24243 | G-PROTEIN COUPLED RECEPTOR | 58 | 139 | 2.2E-25 |
| 5 | g9320.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 88 | 112 | 2.6E-11 |
| 4 | g9320.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 121 | 142 | 2.6E-11 |
| 1 | g9320.t1 | Pfam | PF00001 | 7 transmembrane receptor (rhodopsin family) | 103 | 144 | 5.1E-9 |
| 10 | g9320.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 85 | - |
| 12 | g9320.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 86 | 112 | - |
| 9 | g9320.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 113 | 123 | - |
| 13 | g9320.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 124 | 145 | - |
| 11 | g9320.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 146 | 146 | - |
| 17 | g9320.t1 | ProSiteProfiles | PS50262 | G-protein coupled receptors family 1 profile. | 103 | 146 | 12.167 |
| 6 | g9320.t1 | SUPERFAMILY | SSF81321 | Family A G protein-coupled receptor-like | 59 | 139 | 5.22E-15 |
| 7 | g9320.t1 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM | 1 | 27 | - |
| 16 | g9320.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 34 | - |
| 14 | g9320.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 89 | 111 | - |
| 15 | g9320.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 123 | 145 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0007186 | G protein-coupled receptor signaling pathway | BP |
| GO:0016021 | integral component of membrane | CC |
| GO:0004930 | G protein-coupled receptor activity | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed