Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative Calmodulin.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g9359 g9359.t1 isoform g9359.t1 2250478 2250954
chr_1 g9359 g9359.t1 exon g9359.t1.exon1 2250478 2250954
chr_1 g9359 g9359.t1 cds g9359.t1.CDS1 2250478 2250954
chr_1 g9359 g9359.t1 TSS g9359.t1 2251006 2251006
chr_1 g9359 g9359.t1 TTS g9359.t1 NA NA

Sequences

>g9359.t1 Gene=g9359 Length=477
ATGGATGACGTACAGGAAAGAATGTCAAAATTAACAGAAGACCAGTTGCAAGAAATACGA
GAAGCTTTTGCAATTTATGATAAAGATGGAGATGGAAAAATTTCCTATCGTGAACTAGGA
ACAGTGTTGCGTTCTTTAGGATTATCGCCAACAGAACATGAAATCATTAGATTTATAAGT
CGTCATGATAGAGATGGCGATGGCACAATAAGTTTTGATGAATTTGCAATATCTTTTGCA
GACAAAATGAGAAAAGTTAAAACTGAAGAGGATGTTCTTGATGCTTTTCGTGTACTTGAT
ATTGAAAAAAGCGGTACAATCACTGTCACTCGTTTACGTCATGTGTTACAAACTTTAGGC
GATAAATTAAGTGATGAAGAAATACAATCAATGATTGAAGAAGCAGATGATGATGGCGAT
GGATTAATAAACTATAAAGATTTTGTTCGTATTATGTTTGCAAAAGAAAAAGATTAA

>g9359.t1 Gene=g9359 Length=158
MDDVQERMSKLTEDQLQEIREAFAIYDKDGDGKISYRELGTVLRSLGLSPTEHEIIRFIS
RHDRDGDGTISFDEFAISFADKMRKVKTEEDVLDAFRVLDIEKSGTITVTRLRHVLQTLG
DKLSDEEIQSMIEEADDDGDGLINYKDFVRIMFAKEKD

Protein features from InterProScan

Transcript Database ID Name Start End E.value
13 g9359.t1 Gene3D G3DSA:1.10.238.10 - 1 86 4.2E-28
14 g9359.t1 Gene3D G3DSA:1.10.238.10 - 87 158 9.3E-22
3 g9359.t1 PANTHER PTHR23050 CALCIUM BINDING PROTEIN 9 155 1.6E-47
4 g9359.t1 PANTHER PTHR23050:SF438 CALMODULIN-7 9 155 1.6E-47
2 g9359.t1 Pfam PF13499 EF-hand domain pair 17 76 7.3E-15
1 g9359.t1 Pfam PF13499 EF-hand domain pair 90 152 2.2E-13
12 g9359.t1 ProSitePatterns PS00018 EF-hand calcium-binding domain. 27 39 -
10 g9359.t1 ProSitePatterns PS00018 EF-hand calcium-binding domain. 63 75 -
11 g9359.t1 ProSitePatterns PS00018 EF-hand calcium-binding domain. 136 148 -
18 g9359.t1 ProSiteProfiles PS50222 EF-hand calcium-binding domain profile. 14 49 16.299
15 g9359.t1 ProSiteProfiles PS50222 EF-hand calcium-binding domain profile. 50 85 12.198
17 g9359.t1 ProSiteProfiles PS50222 EF-hand calcium-binding domain profile. 87 122 10.748
16 g9359.t1 ProSiteProfiles PS50222 EF-hand calcium-binding domain profile. 123 158 12.393
8 g9359.t1 SMART SM00054 efh_1 18 46 6.1E-8
6 g9359.t1 SMART SM00054 efh_1 54 82 0.11
7 g9359.t1 SMART SM00054 efh_1 91 119 2.3
9 g9359.t1 SMART SM00054 efh_1 127 155 1.2E-4
5 g9359.t1 SUPERFAMILY SSF47473 EF-hand 7 153 2.77E-47

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0005509 calcium ion binding MF

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed