| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g9403 | g9403.t1 | TSS | g9403.t1 | 2646783 | 2646783 |
| chr_1 | g9403 | g9403.t1 | isoform | g9403.t1 | 2646886 | 2648105 |
| chr_1 | g9403 | g9403.t1 | exon | g9403.t1.exon1 | 2646886 | 2646927 |
| chr_1 | g9403 | g9403.t1 | cds | g9403.t1.CDS1 | 2646886 | 2646927 |
| chr_1 | g9403 | g9403.t1 | exon | g9403.t1.exon2 | 2647634 | 2647991 |
| chr_1 | g9403 | g9403.t1 | cds | g9403.t1.CDS2 | 2647634 | 2647991 |
| chr_1 | g9403 | g9403.t1 | exon | g9403.t1.exon3 | 2648050 | 2648105 |
| chr_1 | g9403 | g9403.t1 | cds | g9403.t1.CDS3 | 2648050 | 2648105 |
| chr_1 | g9403 | g9403.t1 | TTS | g9403.t1 | 2648132 | 2648132 |
>g9403.t1 Gene=g9403 Length=456
ATGGCTAAAAAAATTCCAGCAGAGAAACTTAAAGAATATCAAGAAGTTTTCAATGTCTAC
GACATCAATAGAGATGGACAAATAAACACATCAGAACTAGATACAGTAATGAAAGTCCTT
GGTGAAGAATTAACAGAAGCACGACTTCAAAAACTCATAAATGAAGTTGATCTCGATGGA
AGTGGTACAATAAATTTTGATGAATTTATCAAACTGATGCAAAAAGTTGAAGAGACAGAT
TTTGAAAAAGCAGAATCACTTCGTGCTGCTTTTAAAGTTTTTGACAAGGACAACAATGGT
TTTGTATCATTTGATGAATTGAAATATATTTTGACAAGTTTTGGTGAGAAATTGACTGAT
GAAGAAGTTCAAGATATTTTACATGAAGCTGATAAAGATCGTAATGGAAAACTTGATTAT
GAAGAATTCATTGCAATGTATTTGGAAAAAGAATAA
>g9403.t1 Gene=g9403 Length=151
MAKKIPAEKLKEYQEVFNVYDINRDGQINTSELDTVMKVLGEELTEARLQKLINEVDLDG
SGTINFDEFIKLMQKVEETDFEKAESLRAAFKVFDKDNNGFVSFDELKYILTSFGEKLTD
EEVQDILHEADKDRNGKLDYEEFIAMYLEKE
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 14 | g9403.t1 | Gene3D | G3DSA:1.10.238.10 | - | 1 | 77 | 6.0E-25 |
| 15 | g9403.t1 | Gene3D | G3DSA:1.10.238.10 | - | 78 | 151 | 3.9E-25 |
| 3 | g9403.t1 | PANTHER | PTHR23050:SF413 | CALMODULIN-LIKE PROTEIN 10 | 1 | 147 | 7.7E-44 |
| 4 | g9403.t1 | PANTHER | PTHR23050 | CALCIUM BINDING PROTEIN | 1 | 147 | 7.7E-44 |
| 1 | g9403.t1 | Pfam | PF13499 | EF-hand domain pair | 13 | 74 | 4.8E-14 |
| 2 | g9403.t1 | Pfam | PF13499 | EF-hand domain pair | 85 | 147 | 1.9E-15 |
| 13 | g9403.t1 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 21 | 33 | - |
| 11 | g9403.t1 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 57 | 69 | - |
| 12 | g9403.t1 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 95 | 107 | - |
| 10 | g9403.t1 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 131 | 143 | - |
| 16 | g9403.t1 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 8 | 43 | 14.039 |
| 17 | g9403.t1 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 44 | 79 | 14.179 |
| 18 | g9403.t1 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 82 | 117 | 16.606 |
| 19 | g9403.t1 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 118 | 151 | 13.23 |
| 7 | g9403.t1 | SMART | SM00054 | efh_1 | 12 | 40 | 1.3E-4 |
| 6 | g9403.t1 | SMART | SM00054 | efh_1 | 48 | 76 | 3.0E-7 |
| 9 | g9403.t1 | SMART | SM00054 | efh_1 | 86 | 114 | 2.7E-7 |
| 8 | g9403.t1 | SMART | SM00054 | efh_1 | 122 | 150 | 1.8E-4 |
| 5 | g9403.t1 | SUPERFAMILY | SSF47473 | EF-hand | 2 | 148 | 1.64E-45 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005509 | calcium ion binding | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed