| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g941 | g941.t1 | TTS | g941.t1 | 6986672 | 6986672 |
| chr_3 | g941 | g941.t1 | isoform | g941.t1 | 6986834 | 6987141 |
| chr_3 | g941 | g941.t1 | exon | g941.t1.exon1 | 6986834 | 6986862 |
| chr_3 | g941 | g941.t1 | cds | g941.t1.CDS1 | 6986834 | 6986862 |
| chr_3 | g941 | g941.t1 | exon | g941.t1.exon2 | 6986922 | 6987141 |
| chr_3 | g941 | g941.t1 | cds | g941.t1.CDS2 | 6986922 | 6987141 |
| chr_3 | g941 | g941.t1 | TSS | g941.t1 | 6987698 | 6987698 |
>g941.t1 Gene=g941 Length=249
ATGTGCCGATTTTTGTATTATGATGAAATTCCAAAAATTGATTCACTTGCTCTTCCTTTA
TTAATTGCTGCTGATAAATATATGATCAATGATTTAGCTAACAAATGTGAAAAATTTTTG
ATGTTAAACATAACTATTGGGAATTTTCATGAAGCTTTGGTAACTGCTGATCAACTAAAT
AAAAATAAATTGCGTGAAGCCACAATTGATTCATCATTGCAAACCGTAAATCGATTTTCC
CATCTGTAA
>g941.t1 Gene=g941 Length=82
MCRFLYYDEIPKIDSLALPLLIAADKYMINDLANKCEKFLMLNITIGNFHEALVTADQLN
KNKLREATIDSSLQTVNRFSHL
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g941.t1 | Gene3D | G3DSA:3.30.710.10 | Potassium Channel Kv1.1; Chain A | 1 | 72 | 0.0e+00 |
| 1 | g941.t1 | SUPERFAMILY | SSF54695 | POZ domain | 2 | 41 | 3.4e-05 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed