General information for g9526.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as 14-3-3 protein epsilon.
Parent gene
- The parent gene g9526 is located on chr_1: 3903004..3904146 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g9526 | g9526.t1 | TTS | g9526.t1 | 3895979 | 3895979 |
| chr_1 | g9526 | g9526.t1 | isoform | g9526.t1 | 3896277 | 3904146 |
| chr_1 | g9526 | g9526.t1 | exon | g9526.t1.exon1 | 3896277 | 3896332 |
| chr_1 | g9526 | g9526.t1 | cds | g9526.t1.CDS1 | 3896277 | 3896332 |
| chr_1 | g9526 | g9526.t1 | exon | g9526.t1.exon2 | 3896395 | 3896555 |
| chr_1 | g9526 | g9526.t1 | cds | g9526.t1.CDS2 | 3896395 | 3896555 |
| chr_1 | g9526 | g9526.t1 | exon | g9526.t1.exon3 | 3896620 | 3897109 |
| chr_1 | g9526 | g9526.t1 | cds | g9526.t1.CDS3 | 3896620 | 3897109 |
| chr_1 | g9526 | g9526.t1 | exon | g9526.t1.exon4 | 3904083 | 3904146 |
| chr_1 | g9526 | g9526.t1 | cds | g9526.t1.CDS4 | 3904083 | 3904146 |
| chr_1 | g9526 | g9526.t1 | TSS | g9526.t1 | 3904225 | 3904225 |
Sequences
>g9526.t1 Gene=g9526 Length=771
ATGTCTGAACGAGAGAATAACGTTTACAAGGCTAAATTGGCAGAACAAGCAGAACGATAT
GATGAAATGGTTGATGCTATGAAGAAGGTGGCTTCAACAGACGTTGAATTAACAGTTGAG
GAACGTAATTTATTGTCAGTCGCCTACAAAAATGTCATTGGAGCTAGACGTGCATCCTGG
CGTATCATTTCATCAATCGAACAGAAAGAAGAAAACAAGGGAGTTGAAGAAAAATTGGAA
ATGATCAAAAATTATCGAGCACAAGTAGAGAAGGAACTACGAGATATATGCTCGGATATC
TTGGACGTTTTGGACAAACATCTCATACCATGCGCAACAACAGGCGAATCTAAAGTATTT
TACTATAAGATGAAGGGCGATTATCACCGTTATTTGGCCGAATTTGCAACTGGAAATGAC
CGCAAAGAAGCAGCCGAAAATTCACTAGTAGCTTACAAAGCTGCCAGTGATATTGCTATG
ACCGATCTACCACCCACACATCCAATCCGATTGGGACTCGCATTGAACTTTTCGGTGTTT
TATTATGAGATTTTGAACGCGCCAGACAGAGCTTGCAGATTAGCGAAAGCCGCATTTGAT
GATGCTATTGCAGAATTGGATACACTCAGCGAAGAAAGCTATAAAGATTCCACACTAATT
ATGCAATTATTAAGAGACAACTTAACTCTTTGGACATCAGATATGCAGGGAGATGGTGAA
GGTGAACAGAAAGAGCCCATCCAAGATGTTGAAGATCAGGATGTGTCGTAA
>g9526.t1 Gene=g9526 Length=256
MSERENNVYKAKLAEQAERYDEMVDAMKKVASTDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGVEEKLEMIKNYRAQVEKELRDICSDILDVLDKHLIPCATTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTDLPPTHPIRLGLALNFSVF
YYEILNAPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
GEQKEPIQDVEDQDVS
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 15 | g9526.t1 | CDD | cd10020 | 14-3-3_epsilon | 4 | 233 | 4.33143E-172 |
| 13 | g9526.t1 | Coils | Coil | Coil | 10 | 30 | - |
| 12 | g9526.t1 | Coils | Coil | Coil | 72 | 95 | - |
| 11 | g9526.t1 | Gene3D | G3DSA:1.20.190.20 | - | 1 | 246 | 5.3E-128 |
| 20 | g9526.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 236 | 256 | - |
| 19 | g9526.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 238 | 256 | - |
| 2 | g9526.t1 | PANTHER | PTHR18860 | 14-3-3 PROTEIN | 1 | 254 | 1.8E-151 |
| 3 | g9526.t1 | PANTHER | PTHR18860:SF67 | 14-3-3 PROTEIN EPSILON | 1 | 254 | 1.8E-151 |
| 14 | g9526.t1 | PIRSF | PIRSF000868 | 14-3-3 | 1 | 244 | 1.9E-120 |
| 5 | g9526.t1 | PRINTS | PR00305 | 14-3-3 protein zeta signature | 36 | 65 | 2.6E-86 |
| 8 | g9526.t1 | PRINTS | PR00305 | 14-3-3 protein zeta signature | 85 | 109 | 2.6E-86 |
| 6 | g9526.t1 | PRINTS | PR00305 | 14-3-3 protein zeta signature | 116 | 138 | 2.6E-86 |
| 4 | g9526.t1 | PRINTS | PR00305 | 14-3-3 protein zeta signature | 151 | 177 | 2.6E-86 |
| 9 | g9526.t1 | PRINTS | PR00305 | 14-3-3 protein zeta signature | 178 | 204 | 2.6E-86 |
| 7 | g9526.t1 | PRINTS | PR00305 | 14-3-3 protein zeta signature | 205 | 234 | 2.6E-86 |
| 1 | g9526.t1 | Pfam | PF00244 | 14-3-3 protein | 10 | 232 | 2.3E-108 |
| 17 | g9526.t1 | ProSitePatterns | PS00796 | 14-3-3 proteins signature 1. | 42 | 52 | - |
| 18 | g9526.t1 | ProSitePatterns | PS00797 | 14-3-3 proteins signature 2. | 214 | 233 | - |
| 16 | g9526.t1 | SMART | SM00101 | 1433_4 | 4 | 245 | 3.1E-180 |
| 10 | g9526.t1 | SUPERFAMILY | SSF48445 | 14-3-3 protein | 1 | 234 | 4.84E-108 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K06630 (14-3-3 protein epsilon)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
