| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g9526 | g9526.t18 | TTS | g9526.t18 | 3895979 | 3895979 |
| chr_1 | g9526 | g9526.t18 | isoform | g9526.t18 | 3896277 | 3897026 |
| chr_1 | g9526 | g9526.t18 | exon | g9526.t18.exon1 | 3896277 | 3896332 |
| chr_1 | g9526 | g9526.t18 | cds | g9526.t18.CDS1 | 3896332 | 3896332 |
| chr_1 | g9526 | g9526.t18 | exon | g9526.t18.exon2 | 3896391 | 3896555 |
| chr_1 | g9526 | g9526.t18 | cds | g9526.t18.CDS2 | 3896391 | 3896555 |
| chr_1 | g9526 | g9526.t18 | exon | g9526.t18.exon3 | 3896620 | 3897026 |
| chr_1 | g9526 | g9526.t18 | cds | g9526.t18.CDS3 | 3896620 | 3896933 |
| chr_1 | g9526 | g9526.t18 | TSS | g9526.t18 | NA | NA |
>g9526.t18 Gene=g9526 Length=628
AAAAATGTCATTGGAGCTAGACGTGCATCCTGGCGTATCATTTCATCAATCGAACAGAAA
GAAGAAAACAAGGGAGTTGAAGAAAAATTGGAAATGATCAAAAATTATCGAGCACAAGTA
GAGAAGGAACTACGAGATATATGCTCGGATATCTTGGACGTTTTGGACAAACATCTCATA
CCATGCGCAACAACAGGCGAATCTAAAGTATTTTACTATAAGATGAAGGGCGATTATCAC
CGTTATTTGGCCGAATTTGCAACTGGAAATGACCGCAAAGAAGCAGCCGAAAATTCACTA
GTAGCTTACAAAGCTGCCAGTGATATTGCTATGACCGATCTACCACCCACACATCCAATC
CGATTGGGACTCGCATTGAACTTTTCGGTGTTTTATTATGAGATTTTGAACGCGCCAGAC
AGAGCTTGCAGATTAGCGAAAGCCGCATTTGATGATGCTATTGCAGAATTGGATACACTC
AGCGAAGAAAGCTATAAAGATTCCACACTAATTATGCAATTATTAAGAGACAACTTAACT
CTTTGGACATCAGATATGCAGGGAGATGGTTAGTGAAGGTGAACAGAAAGAGCCCATCCA
AGATGTTGAAGATCAGGATGTGTCGTAA
>g9526.t18 Gene=g9526 Length=159
MIKNYRAQVEKELRDICSDILDVLDKHLIPCATTGESKVFYYKMKGDYHRYLAEFATGND
RKEAAENSLVAYKAASDIAMTDLPPTHPIRLGLALNFSVFYYEILNAPDRACRLAKAAFD
DAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDG
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 12 | g9526.t18 | Gene3D | G3DSA:1.20.190.20 | - | 1 | 159 | 1.6E-86 |
| 2 | g9526.t18 | PANTHER | PTHR18860 | 14-3-3 PROTEIN | 1 | 157 | 8.4E-99 |
| 3 | g9526.t18 | PANTHER | PTHR18860:SF67 | 14-3-3 PROTEIN EPSILON | 1 | 157 | 8.4E-99 |
| 4 | g9526.t18 | PRINTS | PR00305 | 14-3-3 protein zeta signature | 5 | 29 | 1.6E-70 |
| 7 | g9526.t18 | PRINTS | PR00305 | 14-3-3 protein zeta signature | 36 | 58 | 1.6E-70 |
| 8 | g9526.t18 | PRINTS | PR00305 | 14-3-3 protein zeta signature | 71 | 97 | 1.6E-70 |
| 5 | g9526.t18 | PRINTS | PR00305 | 14-3-3 protein zeta signature | 98 | 124 | 1.6E-70 |
| 6 | g9526.t18 | PRINTS | PR00305 | 14-3-3 protein zeta signature | 125 | 154 | 1.6E-70 |
| 1 | g9526.t18 | Pfam | PF00244 | 14-3-3 protein | 1 | 152 | 4.4E-75 |
| 11 | g9526.t18 | ProSitePatterns | PS00797 | 14-3-3 proteins signature 2. | 134 | 153 | - |
| 10 | g9526.t18 | SMART | SM00101 | 1433_4 | 1 | 159 | 4.3E-81 |
| 9 | g9526.t18 | SUPERFAMILY | SSF48445 | 14-3-3 protein | 1 | 154 | 1.2E-73 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed