| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g9526 | g9526.t25 | TTS | g9526.t25 | 3895979 | 3895979 |
| chr_1 | g9526 | g9526.t25 | isoform | g9526.t25 | 3896277 | 3904146 |
| chr_1 | g9526 | g9526.t25 | exon | g9526.t25.exon1 | 3896277 | 3896332 |
| chr_1 | g9526 | g9526.t25 | cds | g9526.t25.CDS1 | 3896277 | 3896332 |
| chr_1 | g9526 | g9526.t25 | exon | g9526.t25.exon2 | 3896395 | 3896555 |
| chr_1 | g9526 | g9526.t25 | cds | g9526.t25.CDS2 | 3896395 | 3896555 |
| chr_1 | g9526 | g9526.t25 | exon | g9526.t25.exon3 | 3896620 | 3896804 |
| chr_1 | g9526 | g9526.t25 | cds | g9526.t25.CDS3 | 3896620 | 3896804 |
| chr_1 | g9526 | g9526.t25 | exon | g9526.t25.exon4 | 3896971 | 3897109 |
| chr_1 | g9526 | g9526.t25 | exon | g9526.t25.exon5 | 3904083 | 3904146 |
| chr_1 | g9526 | g9526.t25 | TSS | g9526.t25 | 3904225 | 3904225 |
>g9526.t25 Gene=g9526 Length=605
ATGTCTGAACGAGAGAATAACGTTTACAAGGCTAAATTGGCAGAACAAGCAGAACGATAT
GATGAAATGGTTGATGCTATGAAGAAGGTGGCTTCAACAGACGTTGAATTAACAGTTGAG
GAACGTAATTTATTGTCAGTCGCCTACAAAAATGTCATTGGAGCTAGACGTGCATCCTGG
CGTATCATTTCATCAATCGAACAATGAAGGGCGATTATCACCGTTATTTGGCCGAATTTG
CAACTGGAAATGACCGCAAAGAAGCAGCCGAAAATTCACTAGTAGCTTACAAAGCTGCCA
GTGATATTGCTATGACCGATCTACCACCCACACATCCAATCCGATTGGGACTCGCATTGA
ACTTTTCGGTGTTTTATTATGAGATTTTGAACGCGCCAGACAGAGCTTGCAGATTAGCGA
AAGCCGCATTTGATGATGCTATTGCAGAATTGGATACACTCAGCGAAGAAAGCTATAAAG
ATTCCACACTAATTATGCAATTATTAAGAGACAACTTAACTCTTTGGACATCAGATATGC
AGGGAGATGGTGAAGGTGAACAGAAAGAGCCCATCCAAGATGTTGAAGATCAGGATGTGT
CGTAA
>g9526.t25 Gene=g9526 Length=133
MKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTDLPPTHPIRLGLALNFSVFYYE
ILNAPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEGEQ
KEPIQDVEDQDVS
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g9526.t25 | Gene3D | G3DSA:1.20.190.20 | - | 1 | 123 | 3.5E-63 |
| 11 | g9526.t25 | MobiDBLite | mobidb-lite | consensus disorder prediction | 111 | 133 | - |
| 12 | g9526.t25 | MobiDBLite | mobidb-lite | consensus disorder prediction | 115 | 133 | - |
| 2 | g9526.t25 | PANTHER | PTHR18860 | 14-3-3 PROTEIN | 1 | 131 | 6.3E-78 |
| 3 | g9526.t25 | PANTHER | PTHR18860:SF67 | 14-3-3 PROTEIN EPSILON | 1 | 131 | 6.3E-78 |
| 6 | g9526.t25 | PRINTS | PR00305 | 14-3-3 protein zeta signature | 28 | 54 | 1.0E-42 |
| 4 | g9526.t25 | PRINTS | PR00305 | 14-3-3 protein zeta signature | 55 | 81 | 1.0E-42 |
| 5 | g9526.t25 | PRINTS | PR00305 | 14-3-3 protein zeta signature | 82 | 111 | 1.0E-42 |
| 1 | g9526.t25 | Pfam | PF00244 | 14-3-3 protein | 1 | 109 | 7.9E-55 |
| 9 | g9526.t25 | ProSitePatterns | PS00797 | 14-3-3 proteins signature 2. | 91 | 110 | - |
| 10 | g9526.t25 | SMART | SM00101 | 1433_4 | 1 | 122 | 4.7E-42 |
| 7 | g9526.t25 | SUPERFAMILY | SSF48445 | 14-3-3 protein | 1 | 117 | 5.49E-54 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed