Gene loci information

Transcript annotation

  • This transcript has been annotated as 14-3-3 protein epsilon.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g9526 g9526.t25 TTS g9526.t25 3895979 3895979
chr_1 g9526 g9526.t25 isoform g9526.t25 3896277 3904146
chr_1 g9526 g9526.t25 exon g9526.t25.exon1 3896277 3896332
chr_1 g9526 g9526.t25 cds g9526.t25.CDS1 3896277 3896332
chr_1 g9526 g9526.t25 exon g9526.t25.exon2 3896395 3896555
chr_1 g9526 g9526.t25 cds g9526.t25.CDS2 3896395 3896555
chr_1 g9526 g9526.t25 exon g9526.t25.exon3 3896620 3896804
chr_1 g9526 g9526.t25 cds g9526.t25.CDS3 3896620 3896804
chr_1 g9526 g9526.t25 exon g9526.t25.exon4 3896971 3897109
chr_1 g9526 g9526.t25 exon g9526.t25.exon5 3904083 3904146
chr_1 g9526 g9526.t25 TSS g9526.t25 3904225 3904225

Sequences

>g9526.t25 Gene=g9526 Length=605
ATGTCTGAACGAGAGAATAACGTTTACAAGGCTAAATTGGCAGAACAAGCAGAACGATAT
GATGAAATGGTTGATGCTATGAAGAAGGTGGCTTCAACAGACGTTGAATTAACAGTTGAG
GAACGTAATTTATTGTCAGTCGCCTACAAAAATGTCATTGGAGCTAGACGTGCATCCTGG
CGTATCATTTCATCAATCGAACAATGAAGGGCGATTATCACCGTTATTTGGCCGAATTTG
CAACTGGAAATGACCGCAAAGAAGCAGCCGAAAATTCACTAGTAGCTTACAAAGCTGCCA
GTGATATTGCTATGACCGATCTACCACCCACACATCCAATCCGATTGGGACTCGCATTGA
ACTTTTCGGTGTTTTATTATGAGATTTTGAACGCGCCAGACAGAGCTTGCAGATTAGCGA
AAGCCGCATTTGATGATGCTATTGCAGAATTGGATACACTCAGCGAAGAAAGCTATAAAG
ATTCCACACTAATTATGCAATTATTAAGAGACAACTTAACTCTTTGGACATCAGATATGC
AGGGAGATGGTGAAGGTGAACAGAAAGAGCCCATCCAAGATGTTGAAGATCAGGATGTGT
CGTAA

>g9526.t25 Gene=g9526 Length=133
MKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTDLPPTHPIRLGLALNFSVFYYE
ILNAPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEGEQ
KEPIQDVEDQDVS

Protein features from InterProScan

Transcript Database ID Name Start End E.value
8 g9526.t25 Gene3D G3DSA:1.20.190.20 - 1 123 3.5E-63
11 g9526.t25 MobiDBLite mobidb-lite consensus disorder prediction 111 133 -
12 g9526.t25 MobiDBLite mobidb-lite consensus disorder prediction 115 133 -
2 g9526.t25 PANTHER PTHR18860 14-3-3 PROTEIN 1 131 6.3E-78
3 g9526.t25 PANTHER PTHR18860:SF67 14-3-3 PROTEIN EPSILON 1 131 6.3E-78
6 g9526.t25 PRINTS PR00305 14-3-3 protein zeta signature 28 54 1.0E-42
4 g9526.t25 PRINTS PR00305 14-3-3 protein zeta signature 55 81 1.0E-42
5 g9526.t25 PRINTS PR00305 14-3-3 protein zeta signature 82 111 1.0E-42
1 g9526.t25 Pfam PF00244 14-3-3 protein 1 109 7.9E-55
9 g9526.t25 ProSitePatterns PS00797 14-3-3 proteins signature 2. 91 110 -
10 g9526.t25 SMART SM00101 1433_4 1 122 4.7E-42
7 g9526.t25 SUPERFAMILY SSF48445 14-3-3 protein 1 117 5.49E-54

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed