Gene loci information

Transcript annotation

  • This transcript has been not been annotated.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g9550 g9550.t1 isoform g9550.t1 4035638 4036040
chr_1 g9550 g9550.t1 exon g9550.t1.exon1 4035638 4035660
chr_1 g9550 g9550.t1 cds g9550.t1.CDS1 4035638 4035660
chr_1 g9550 g9550.t1 exon g9550.t1.exon2 4035717 4035784
chr_1 g9550 g9550.t1 cds g9550.t1.CDS2 4035717 4035784
chr_1 g9550 g9550.t1 exon g9550.t1.exon3 4035841 4036040
chr_1 g9550 g9550.t1 cds g9550.t1.CDS3 4035841 4036040
chr_1 g9550 g9550.t1 TTS g9550.t1 4036077 4036077
chr_1 g9550 g9550.t1 TSS g9550.t1 NA NA

Sequences

>g9550.t1 Gene=g9550 Length=291
ATGGAAATAAAACTTGATTTTGGAGGAGGTGCAGAAGTATTGTTCGACAACATTAAAAAG
AGAGATCTCACATTAGATTCAAGTAAAAAATGGACAATCAGAACATTCCTTCAATACATG
AAAGAGAATCTTTTGACCGATAGAGAAGAGCTTTTTTTACAAGGAGAATGTGTTAGACCT
GGAATACTAGTTCTCATAAACGACACAGATTGGGAGTTATTAGGAGAGCTAGATTATGAA
ATACAGCCAAATGATAACATTTCTTTTATTTCAACACTCCATGGAGGATAA

>g9550.t1 Gene=g9550 Length=96
MEIKLDFGGGAEVLFDNIKKRDLTLDSSKKWTIRTFLQYMKENLLTDREELFLQGECVRP
GILVLINDTDWELLGELDYEIQPNDNISFISTLHGG

Protein features from InterProScan

Transcript Database ID Name Start End E.value
7 g9550.t1 CDD cd01764 Ubl_Urm1 3 96 0.00000
5 g9550.t1 Gene3D G3DSA:3.10.20.30 - 1 96 0.00000
3 g9550.t1 Hamap MF_03048 Ubiquitin-related modifier 1 [URM1]. 1 96 32.42351
2 g9550.t1 PANTHER PTHR14986 RURM1 PROTEIN 1 96 0.00000
6 g9550.t1 PIRSF PIRSF037379 Urm1 1 96 0.00000
1 g9550.t1 Pfam PF09138 Urm1 (Ubiquitin related modifier) 2 96 0.00000
4 g9550.t1 SUPERFAMILY SSF54285 MoaD/ThiS 1 96 0.00000

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0034227 tRNA thio-modification BP
GO:0005737 cytoplasm CC

KEGG

Orthology

Pathway

  • This transcript belongs to the following pathways

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values