General information for g9622.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Protein zntD.
Parent gene
- The parent gene g9622 is located on chr_1: 4318341..4319499 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g9622 | g9622.t1 | TSS | g9622.t1 | 4318006 | 4318006 |
| chr_1 | g9622 | g9622.t1 | isoform | g9622.t1 | 4318341 | 4319499 |
| chr_1 | g9622 | g9622.t1 | exon | g9622.t1.exon1 | 4318341 | 4318384 |
| chr_1 | g9622 | g9622.t1 | cds | g9622.t1.CDS1 | 4318341 | 4318384 |
| chr_1 | g9622 | g9622.t1 | exon | g9622.t1.exon2 | 4318441 | 4318582 |
| chr_1 | g9622 | g9622.t1 | cds | g9622.t1.CDS2 | 4318441 | 4318582 |
| chr_1 | g9622 | g9622.t1 | exon | g9622.t1.exon3 | 4318641 | 4319133 |
| chr_1 | g9622 | g9622.t1 | cds | g9622.t1.CDS3 | 4318641 | 4319133 |
| chr_1 | g9622 | g9622.t1 | exon | g9622.t1.exon4 | 4319192 | 4319499 |
| chr_1 | g9622 | g9622.t1 | cds | g9622.t1.CDS4 | 4319192 | 4319499 |
| chr_1 | g9622 | g9622.t1 | TTS | g9622.t1 | 4319666 | 4319666 |
Sequences
>g9622.t1 Gene=g9622 Length=987
ATGAATCCTGAATGGTCAAAAGTGGTCGTTATGCTAACCTTAGGATTAGGAAGCATGATC
GTTGGAATGATTCCTTTAGCATTTACGCAATATAATTTAAGAAGAAATCCATTGCTATTT
ACATTTCTACTTTGCTTTGGTGCAGGAATTTTGATGGCAACTTCATTAGTGCATATGTTA
CCTGAAGTTAGTGAAGATCTTGGTCATGGTCTCTCAGAAATTATTTTTTGCATAGGATTT
TTAATTGTATATTTGGCCGATGAATTACTTCATTTTTGTATGGGTGAAGCTATACAACAC
AATCATTCTCATAATTTAAATATTGAAGAACAACAACCAATTATGCATCAACATTCACAT
CATCGTCGAAGTAAAACTCCATCATATGGATCAGTGGAAGAGTATCAACATCAATCATGT
GAAGAACATCAGCATCAACATGATATTGAAGATGAAAGAATAAATGAAAGAATTTGTCAT
ACAACTCATATTGAACCTTGCAATCAAACGCTAGCTGGCGTTATTGGAATGCTGACTGCT
CTCTCAGTACATTCTTTGATTGAAGGACTTGCTATAGGTATTCAAGACTCGACATCTAAA
GTAATGCTTCTTTTTGGTGCTGTTGTCTCACATAAATTCGTTGTTGGTTTTTGTTTAGGT
GTAGAACTATCAGCTTCTGCTGGTGCAAAATTTCTTCATCATTTCATAGCAATATTTGTA
TTCTCAGCCGGTAGTGTTTTAGGCATTGGAATTGGAATGGCGCTTGTCGATCTAAATTCA
GTTGTTGACTCAAAATTCTTACCAATTATGCAAGGTATTGCTGGTGGAACTCTTTTGTAC
GTTACTGTTTGTGAGGTTCTTCCTAGAGAAAAAGCACGTTGGCATCAAAACCGAGTTAAT
AAAGCGGCAGGTTTAGCACAATTGCTGGCTTTCACATTAGGATTTGCTGTAATGACACTT
TTAAATATGTATGTAACTGAAAATTAA
>g9622.t1 Gene=g9622 Length=328
MNPEWSKVVVMLTLGLGSMIVGMIPLAFTQYNLRRNPLLFTFLLCFGAGILMATSLVHML
PEVSEDLGHGLSEIIFCIGFLIVYLADELLHFCMGEAIQHNHSHNLNIEEQQPIMHQHSH
HRRSKTPSYGSVEEYQHQSCEEHQHQHDIEDERINERICHTTHIEPCNQTLAGVIGMLTA
LSVHSLIEGLAIGIQDSTSKVMLLFGAVVSHKFVVGFCLGVELSASAGAKFLHHFIAIFV
FSAGSVLGIGIGMALVDLNSVVDSKFLPIMQGIAGGTLLYVTVCEVLPREKARWHQNRVN
KAAGLAQLLAFTLGFAVMTLLNMYVTEN
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g9622.t1 | PANTHER | PTHR11040:SF169 | FI24038P1 | 6 | 326 | 7.6E-98 |
| 3 | g9622.t1 | PANTHER | PTHR11040 | ZINC/IRON TRANSPORTER | 6 | 326 | 7.6E-98 |
| 1 | g9622.t1 | Pfam | PF02535 | ZIP Zinc transporter | 7 | 321 | 1.7E-59 |
| 19 | g9622.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 5 | - |
| 25 | g9622.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 6 | 26 | - |
| 14 | g9622.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 27 | 37 | - |
| 21 | g9622.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 38 | 61 | - |
| 18 | g9622.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 62 | 66 | - |
| 24 | g9622.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 67 | 86 | - |
| 12 | g9622.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 87 | 170 | - |
| 23 | g9622.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 171 | 195 | - |
| 17 | g9622.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 196 | 200 | - |
| 26 | g9622.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 201 | 223 | - |
| 15 | g9622.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 224 | 234 | - |
| 27 | g9622.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 235 | 256 | - |
| 20 | g9622.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 257 | 267 | - |
| 22 | g9622.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 268 | 287 | - |
| 13 | g9622.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 288 | 307 | - |
| 28 | g9622.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 308 | 325 | - |
| 16 | g9622.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 326 | 328 | - |
| 6 | g9622.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 10 | 29 | - |
| 7 | g9622.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 38 | 60 | - |
| 5 | g9622.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 70 | 92 | - |
| 11 | g9622.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 170 | 192 | - |
| 4 | g9622.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 202 | 221 | - |
| 10 | g9622.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 234 | 256 | - |
| 9 | g9622.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 266 | 283 | - |
| 8 | g9622.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 304 | 326 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016020 | membrane | CC |
| GO:0055085 | transmembrane transport | BP |
| GO:0046873 | metal ion transmembrane transporter activity | MF |
| GO:0030001 | metal ion transport | BP |
KEGG
Orthology
- This transcript has been annotated with K14709 (solute carrier family 39 (zinc transporter), member 1/2/3)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
