| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g9709 | g9709.t1 | TTS | g9709.t1 | 4762922 | 4762922 |
| chr_1 | g9709 | g9709.t1 | isoform | g9709.t1 | 4763068 | 4763595 |
| chr_1 | g9709 | g9709.t1 | exon | g9709.t1.exon1 | 4763068 | 4763096 |
| chr_1 | g9709 | g9709.t1 | cds | g9709.t1.CDS1 | 4763068 | 4763096 |
| chr_1 | g9709 | g9709.t1 | exon | g9709.t1.exon2 | 4763164 | 4763379 |
| chr_1 | g9709 | g9709.t1 | cds | g9709.t1.CDS2 | 4763164 | 4763379 |
| chr_1 | g9709 | g9709.t1 | exon | g9709.t1.exon3 | 4763517 | 4763595 |
| chr_1 | g9709 | g9709.t1 | cds | g9709.t1.CDS3 | 4763517 | 4763595 |
| chr_1 | g9709 | g9709.t1 | TSS | g9709.t1 | 4763652 | 4763652 |
>g9709.t1 Gene=g9709 Length=324
ATGGGATTTGGTGATTATCCAGCAGAATACAATCCAAAGATTCATGGCGTCTATGATCCA
GCACGCTATTATGGCAAACCTGATACTCCATTGAGTCAGGTTAAATTAAACGAGTTAGGT
GCATGGATCGGAAGAAGAAATAAGACACCAAGTGCTATTGCAGGAGCTTGCTCAAGAGCT
TGGTGGAGATGGCAACATAAGTATATGCAGCCACGCCGCAGTACAATGGCTCCTTATTTC
CAATTGATTGTTGGCTCAATGATCTTCTTTTATGCTATTAATTATGGCAAAATCACTGCA
CACAGAAATTACAAATACCATTAA
>g9709.t1 Gene=g9709 Length=107
MGFGDYPAEYNPKIHGVYDPARYYGKPDTPLSQVKLNELGAWIGRRNKTPSAIAGACSRA
WWRWQHKYMQPRRSTMAPYFQLIVGSMIFFYAINYGKITAHRNYKYH
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g9709.t1 | PANTHER | PTHR13080:SF5 | ATP SYNTHASE SUBUNIT F, MITOCHONDRIAL-RELATED | 1 | 107 | 5.6E-39 |
| 3 | g9709.t1 | PANTHER | PTHR13080 | ATP SYNTHASE F CHAIN, MITOCHONDRIAL-RELATED | 1 | 107 | 5.6E-39 |
| 1 | g9709.t1 | Pfam | PF10206 | Mitochondrial F1F0-ATP synthase, subunit f | 3 | 103 | 2.0E-51 |
| 6 | g9709.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 75 | - |
| 7 | g9709.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 76 | 95 | - |
| 5 | g9709.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 96 | 107 | - |
| 4 | g9709.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 77 | 96 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.