| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g9715 | g9715.t19 | TSS | g9715.t19 | 4777068 | 4777068 |
| chr_1 | g9715 | g9715.t19 | isoform | g9715.t19 | 4777159 | 4779393 |
| chr_1 | g9715 | g9715.t19 | exon | g9715.t19.exon1 | 4777159 | 4777161 |
| chr_1 | g9715 | g9715.t19 | cds | g9715.t19.CDS1 | 4777159 | 4777161 |
| chr_1 | g9715 | g9715.t19 | exon | g9715.t19.exon2 | 4777312 | 4777467 |
| chr_1 | g9715 | g9715.t19 | cds | g9715.t19.CDS2 | 4777312 | 4777467 |
| chr_1 | g9715 | g9715.t19 | exon | g9715.t19.exon3 | 4777688 | 4777777 |
| chr_1 | g9715 | g9715.t19 | cds | g9715.t19.CDS3 | 4777688 | 4777777 |
| chr_1 | g9715 | g9715.t19 | exon | g9715.t19.exon4 | 4778031 | 4778229 |
| chr_1 | g9715 | g9715.t19 | cds | g9715.t19.CDS4 | 4778031 | 4778147 |
| chr_1 | g9715 | g9715.t19 | exon | g9715.t19.exon5 | 4779348 | 4779393 |
| chr_1 | g9715 | g9715.t19 | TTS | g9715.t19 | NA | NA |
>g9715.t19 Gene=g9715 Length=494
ATGGCGGCCGTTGGTAAAGATATTGAAAAGCAGCAACAAGCTGAAACATCATCAGTTCAT
CGCATTCGCATTGTATTGACTGCATGCAATGTTCGTTCATTGGAAAAAGTTTGCACTGAC
TTGATCTCTGGCGCAAAGAAACAAAAGTTGCGCGTTAAGGGACCAATTCGTATGCCAACA
AATACATTGCGCATCACAACACGTAAAACACCTTGCGGTGAAGGTTCAAAAACCTGGGAT
CGCTTCCAAATGAGAATCCATAAGCGTATCATTGATTTGCACTCACCATCAGAAATTGTG
CGTCAAATCACATCAATTAACATCGAACCAGGTGTACAAGTTGAAGTTACCATTGCCGAC
AATTAAAATGGAAATTTCATCGGAAATTTTAGGAGCACAATTCCTGATTATTAATAAAAT
CTAAATAATATCAAAAATTATGAATGACTTTGTCTTGTATGGTTGACAATACTATATATG
TCAATGCATGAAAA
>g9715.t19 Gene=g9715 Length=121
MAAVGKDIEKQQQAETSSVHRIRIVLTACNVRSLEKVCTDLISGAKKQKLRVKGPIRMPT
NTLRITTRKTPCGEGSKTWDRFQMRIHKRIIDLHSPSEIVRQITSINIEPGVQVEVTIAD
N
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g9715.t19 | Gene3D | G3DSA:3.30.70.600 | - | 6 | 120 | 0.00000 |
| 4 | g9715.t19 | Hamap | MF_00508 | 30S ribosomal protein S10 [rpsJ]. | 19 | 118 | 18.74581 |
| 2 | g9715.t19 | PANTHER | PTHR11700 | 30S RIBOSOMAL PROTEIN S10 FAMILY MEMBER | 9 | 120 | 0.00000 |
| 3 | g9715.t19 | PANTHER | PTHR11700:SF8 | 40S RIBOSOMAL PROTEIN S20 | 9 | 120 | 0.00000 |
| 6 | g9715.t19 | PRINTS | PR00971 | Ribosomal protein S10 family signature | 21 | 34 | 0.00000 |
| 7 | g9715.t19 | PRINTS | PR00971 | Ribosomal protein S10 family signature | 56 | 71 | 0.00000 |
| 5 | g9715.t19 | PRINTS | PR00971 | Ribosomal protein S10 family signature | 78 | 92 | 0.00000 |
| 1 | g9715.t19 | Pfam | PF00338 | Ribosomal protein S10p/S20e | 23 | 117 | 0.00000 |
| 10 | g9715.t19 | SMART | SM01403 | Ribosomal_S10_2 | 23 | 117 | 0.00000 |
| 8 | g9715.t19 | SUPERFAMILY | SSF54999 | Ribosomal protein S10 | 21 | 118 | 0.00000 |
| 11 | g9715.t19 | TIGRFAM | TIGR01046 | uS10_euk_arch: ribosomal protein uS10 | 20 | 118 | 0.00000 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005840 | ribosome | CC |
| GO:0006412 | translation | BP |
| GO:0003735 | structural constituent of ribosome | MF |
| GO:0015935 | small ribosomal subunit | CC |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.