General information for g9717.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Phosphatidylinositol N-acetylglucosaminyltransferase subunit C.
Parent gene
- The parent gene g9717 is located on chr_1: 4784987..4786082 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g9717 | g9717.t1 | TTS | g9717.t1 | 4784952 | 4784952 |
| chr_1 | g9717 | g9717.t1 | isoform | g9717.t1 | 4784987 | 4785835 |
| chr_1 | g9717 | g9717.t1 | exon | g9717.t1.exon1 | 4784987 | 4785835 |
| chr_1 | g9717 | g9717.t1 | cds | g9717.t1.CDS1 | 4784987 | 4785835 |
| chr_1 | g9717 | g9717.t1 | TSS | g9717.t1 | 4785892 | 4785892 |
Sequences
>g9717.t1 Gene=g9717 Length=849
ATGAGTCAACCAAAAAAACCATGGAAGAAAAATTTATACGAGAACAAAGAATATGAAGAC
AACTACACAGATCCAAGTTTCTTAAAAGATTTAAGGCAAAATTACAATTTAGAAAGATAT
ACATATAAAGAATGTTTACTTGGTGTTACAAAAGTTTCGCAAGAAATATCAATAGTGACA
CTCTTTCTAATTGTCTTCTATCATCTGTATCAAAATAGTGTTCAACCACAAACTATATTA
TTCAACTCATTCACAATAACTGGAATCGGCTACCTTTTTTATATTGGCACACCAAATCTG
CAAAAAGCAAAAAATGTCATCGAGGATTCAAAAACTGTTGTAACTGTATTACTATTTGGA
TTTTATTTTAGTCCATTATTGCATACTTTGACTGATTCTATTTCAACTGATACAATATTC
TCAACAACATTCATCATCCTCTTCTTTTATCTATTGATGCATGATTACGGTATTGATGGA
TTTTTAGTGTCTAAAACGATATCACTAAACTGTGGGATATTTTCATCAATTTGCCTAGCA
TCACGACTTTCTACGCCATTTCATGCTTTTGTTTTACTTGTGGTATCATCTGAAGTTTTT
GTTTTAAAGCCGTTATTATTTGAAAAAATGTTTAAACCATACATGCTCATCCCAATTGTT
TTAATTACAATTTATTACTTACTCAGCATTTCTCAACTACTACTCATTGTTTATTTATCA
ACTTTATTCTTCATTAACATTGCATGTCCATATTTATTTCAAAGACTTCATAATCACAAT
AAATTAATTATTAGCGGTCCGTGGGATGAATTTGTAATTATAAGCTCGGAAGAAGATGAA
AATGAATAG
>g9717.t1 Gene=g9717 Length=282
MSQPKKPWKKNLYENKEYEDNYTDPSFLKDLRQNYNLERYTYKECLLGVTKVSQEISIVT
LFLIVFYHLYQNSVQPQTILFNSFTITGIGYLFYIGTPNLQKAKNVIEDSKTVVTVLLFG
FYFSPLLHTLTDSISTDTIFSTTFIILFFYLLMHDYGIDGFLVSKTISLNCGIFSSICLA
SRLSTPFHAFVLLVVSSEVFVLKPLLFEKMFKPYMLIPIVLITIYYLLSISQLLLIVYLS
TLFFINIACPYLFQRLHNHNKLIISGPWDEFVIISSEEDENE
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g9717.t1 | PANTHER | PTHR12982 | PHOSPHATIDYLINOSITOL GLYCAN, CLASS C | 5 | 278 | 8.8E-70 |
| 26 | g9717.t1 | PIRSF | PIRSF016104 | PIG-C | 1 | 279 | 1.3E-78 |
| 1 | g9717.t1 | Pfam | PF06432 | Phosphatidylinositol N-acetylglucosaminyltransferase | 8 | 269 | 8.9E-63 |
| 10 | g9717.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 44 | - |
| 23 | g9717.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 45 | 67 | - |
| 14 | g9717.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 68 | 78 | - |
| 25 | g9717.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 79 | 100 | - |
| 12 | g9717.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 101 | 111 | - |
| 22 | g9717.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 112 | 128 | - |
| 15 | g9717.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 129 | 133 | - |
| 21 | g9717.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 134 | 153 | - |
| 11 | g9717.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 154 | 159 | - |
| 20 | g9717.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 160 | 183 | - |
| 17 | g9717.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 184 | 188 | - |
| 19 | g9717.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 189 | 206 | - |
| 9 | g9717.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 207 | 212 | - |
| 18 | g9717.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 213 | 229 | - |
| 16 | g9717.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 230 | 234 | - |
| 24 | g9717.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 235 | 253 | - |
| 13 | g9717.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 254 | 282 | - |
| 6 | g9717.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 46 | 68 | - |
| 7 | g9717.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 78 | 100 | - |
| 5 | g9717.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 113 | 130 | - |
| 3 | g9717.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 134 | 153 | - |
| 4 | g9717.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 173 | 195 | - |
| 8 | g9717.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 215 | 237 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006506 | GPI anchor biosynthetic process | BP |
| GO:0017176 | phosphatidylinositol N-acetylglucosaminyltransferase activity | MF |
| GO:0016021 | integral component of membrane | CC |
KEGG
Orthology
- This transcript has been annotated with K03859 (phosphatidylinositol N-acetylglucosaminyltransferase subunit C)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
