| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g9739 | g9739.t1 | isoform | g9739.t1 | 4880139 | 4882379 |
| chr_1 | g9739 | g9739.t1 | exon | g9739.t1.exon1 | 4880139 | 4880257 |
| chr_1 | g9739 | g9739.t1 | cds | g9739.t1.CDS1 | 4880139 | 4880257 |
| chr_1 | g9739 | g9739.t1 | exon | g9739.t1.exon2 | 4882187 | 4882379 |
| chr_1 | g9739 | g9739.t1 | cds | g9739.t1.CDS2 | 4882187 | 4882379 |
| chr_1 | g9739 | g9739.t1 | TSS | g9739.t1 | NA | NA |
| chr_1 | g9739 | g9739.t1 | TTS | g9739.t1 | NA | NA |
>g9739.t1 Gene=g9739 Length=312
ATGAGCTTTTTCAGTTCATTAGTCGCCAATGTTACAAGTGGTGTAGCAAATTTAGGTTTA
GGTTCAAGAAGATTTTCACTTTCACGTCAAGATTCAAATGAAGGAAATGTTGCGGACCTT
AGTGGTGCAAAAACTGTTGCAACACCACCGTCAATAACTGTCACATCAACCAGCAACCTT
TCAACTCAACATGATAAAGCAGTACTTGAAGAGAATCGCAGTGCAAATGAATCAACTTTA
GATTTGAATACAACGTCCGATAATGAAAAACAAGAAGATTCTGGTTCTGAAGAGAGGGAT
TTCCACATTTAG
>g9739.t1 Gene=g9739 Length=103
MSFFSSLVANVTSGVANLGLGSRRFSLSRQDSNEGNVADLSGAKTVATPPSITVTSTSNL
STQHDKAVLEENRSANESTLDLNTTSDNEKQEDSGSEERDFHI
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 1 | g9739.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 29 | 103 | - |
| 3 | g9739.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 46 | 65 | - |
| 2 | g9739.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 86 | 103 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed