General information for g9756.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Allatostatin-A receptor.
Parent gene
- The parent gene g9756 is located on chr_1: 5023330..5031516 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g9756 | g9756.t1 | isoform | g9756.t1 | 5023330 | 5031516 |
| chr_1 | g9756 | g9756.t1 | exon | g9756.t1.exon1 | 5023330 | 5023422 |
| chr_1 | g9756 | g9756.t1 | cds | g9756.t1.CDS1 | 5023330 | 5023422 |
| chr_1 | g9756 | g9756.t1 | exon | g9756.t1.exon2 | 5023971 | 5024202 |
| chr_1 | g9756 | g9756.t1 | cds | g9756.t1.CDS2 | 5023971 | 5024202 |
| chr_1 | g9756 | g9756.t1 | exon | g9756.t1.exon3 | 5025673 | 5025788 |
| chr_1 | g9756 | g9756.t1 | cds | g9756.t1.CDS3 | 5025673 | 5025788 |
| chr_1 | g9756 | g9756.t1 | exon | g9756.t1.exon4 | 5028414 | 5028564 |
| chr_1 | g9756 | g9756.t1 | cds | g9756.t1.CDS4 | 5028414 | 5028564 |
| chr_1 | g9756 | g9756.t1 | exon | g9756.t1.exon5 | 5029628 | 5029758 |
| chr_1 | g9756 | g9756.t1 | cds | g9756.t1.CDS5 | 5029628 | 5029758 |
| chr_1 | g9756 | g9756.t1 | exon | g9756.t1.exon6 | 5030452 | 5030519 |
| chr_1 | g9756 | g9756.t1 | cds | g9756.t1.CDS6 | 5030452 | 5030519 |
| chr_1 | g9756 | g9756.t1 | exon | g9756.t1.exon7 | 5030661 | 5030747 |
| chr_1 | g9756 | g9756.t1 | cds | g9756.t1.CDS7 | 5030661 | 5030747 |
| chr_1 | g9756 | g9756.t1 | exon | g9756.t1.exon8 | 5031324 | 5031516 |
| chr_1 | g9756 | g9756.t1 | cds | g9756.t1.CDS8 | 5031324 | 5031516 |
| chr_1 | g9756 | g9756.t1 | TSS | g9756.t1 | NA | NA |
| chr_1 | g9756 | g9756.t1 | TTS | g9756.t1 | NA | NA |
Sequences
>g9756.t1 Gene=g9756 Length=1071
ATGACTGAGCCTTATTTCAACATTTCGAGCAACGGCACAAACATCACTGATCTTTGCTTC
TTCTTTCAAAATTGTACAACTGAAGACGAGTCTTACATTGATGATTTAGAACGTTCTATA
TCGTTGTCAGTTTTCATACTTTTTGGCTTTATATTCATCGCAGGATTAATAGGCAATGGA
TTGGTCGTACTTGTGGTTGCTGCTAATCCTTTAATGCGCTCCACAACAAATATATTAATA
ATAAATCTTGCTGTGGCAGATCTACTTTTTGTGATATTTTGCATTCCTTTCACGGCAACA
GATTACATTCTCAACTCTTGGCCTTTCGGCAGTTTTTTATGCTCTTTTGTTCAATATATG
ATTATAGTTACGTGCCATGCCAGTGTATATACACTTGTACTTATGTCAGTTGATCGATAC
ATTGCGATAGTACATCCAATATCGGGCATTTCTATACGCACTGAAAAAAATGCGACACTT
GCTATAGGAGTTGCATGGCTGTTTATAACTACATGTTGTATTCCGTGGGGATTCGCACAT
GGCCTAGTTACATTTGCAAATGATGAATATGAGGAAGAAACCAAATGTATCTTCTCATCG
CACGAGGGTTACAATCATCCGATATTTCAAATATCATTTTTCTTGTCCTCCTATGTTGTG
CCATTGACTCTCATTTCGGTGCTGTATGTGTGTATGCTTTTGAGCTTATGGAAAGGTACT
GGAACTCGAGTCTCAGCTGAATCAAGACGAGGCAAAAAGCGTGTAACACGAATGATCGTT
GCTGTCGTCTTAGCATTTGCTGCATGCTGGCTGCCTATCCATATCATCTTAGTCCTTAAA
TCGATTAATGCATACCATCAGACCACGACGCTTGTCGCATTTCAAATCATCTCACATGTG
CTAGCGTACACGAATAGTTGCATAAATCCTATACTCTATTGCTTCCTATCTGAGAATTTT
AGAAAGGCATTCCGTAAGGTTGTCAATTGTGGATCACAAAAAAGCTTTCAAACACAAGTA
ACAACGAAAATTGTCACTCGAACAGGAAATGGCCACAAGGATATTTTGTAA
>g9756.t1 Gene=g9756 Length=356
MTEPYFNISSNGTNITDLCFFFQNCTTEDESYIDDLERSISLSVFILFGFIFIAGLIGNG
LVVLVVAANPLMRSTTNILIINLAVADLLFVIFCIPFTATDYILNSWPFGSFLCSFVQYM
IIVTCHASVYTLVLMSVDRYIAIVHPISGISIRTEKNATLAIGVAWLFITTCCIPWGFAH
GLVTFANDEYEEETKCIFSSHEGYNHPIFQISFFLSSYVVPLTLISVLYVCMLLSLWKGT
GTRVSAESRRGKKRVTRMIVAVVLAFAACWLPIHIILVLKSINAYHQTTTLVAFQIISHV
LAYTNSCINPILYCFLSENFRKAFRKVVNCGSQKSFQTQVTTKIVTRTGNGHKDIL
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 32 | g9756.t1 | CDD | cd15096 | 7tmA_AstA_R_insect | 46 | 324 | 3.61112E-129 |
| 16 | g9756.t1 | Gene3D | G3DSA:1.20.1070.10 | - | 17 | 353 | 2.1E-91 |
| 2 | g9756.t1 | PANTHER | PTHR45695 | LEUCOKININ RECEPTOR-RELATED | 26 | 341 | 1.1E-77 |
| 7 | g9756.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 43 | 67 | 1.2E-50 |
| 9 | g9756.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 76 | 97 | 1.2E-50 |
| 14 | g9756.t1 | PRINTS | PR00663 | Galanin receptor signature | 90 | 104 | 1.6E-15 |
| 10 | g9756.t1 | PRINTS | PR00663 | Galanin receptor signature | 107 | 125 | 1.6E-15 |
| 8 | g9756.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 121 | 143 | 1.2E-50 |
| 11 | g9756.t1 | PRINTS | PR00663 | Galanin receptor signature | 149 | 165 | 1.6E-15 |
| 6 | g9756.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 157 | 178 | 1.2E-50 |
| 13 | g9756.t1 | PRINTS | PR00663 | Galanin receptor signature | 205 | 220 | 1.6E-15 |
| 5 | g9756.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 210 | 233 | 1.2E-50 |
| 4 | g9756.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 255 | 279 | 1.2E-50 |
| 12 | g9756.t1 | PRINTS | PR00663 | Galanin receptor signature | 282 | 302 | 1.6E-15 |
| 3 | g9756.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 295 | 321 | 1.2E-50 |
| 1 | g9756.t1 | Pfam | PF00001 | 7 transmembrane receptor (rhodopsin family) | 58 | 313 | 9.7E-59 |
| 22 | g9756.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 39 | - |
| 25 | g9756.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 40 | 67 | - |
| 17 | g9756.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 68 | 78 | - |
| 30 | g9756.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 79 | 104 | - |
| 21 | g9756.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 105 | 115 | - |
| 27 | g9756.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 116 | 137 | - |
| 19 | g9756.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 138 | 157 | - |
| 26 | g9756.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 158 | 178 | - |
| 24 | g9756.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 179 | 207 | - |
| 29 | g9756.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 208 | 237 | - |
| 20 | g9756.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 238 | 257 | - |
| 28 | g9756.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 258 | 279 | - |
| 23 | g9756.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 280 | 290 | - |
| 31 | g9756.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 291 | 316 | - |
| 18 | g9756.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 317 | 356 | - |
| 41 | g9756.t1 | ProSitePatterns | PS00237 | G-protein coupled receptors family 1 signature. | 127 | 143 | - |
| 42 | g9756.t1 | ProSiteProfiles | PS50262 | G-protein coupled receptors family 1 profile. | 58 | 313 | 49.479 |
| 40 | g9756.t1 | SMART | SM01381 | 7TM_GPCR_Srsx_2 | 52 | 328 | 4.2E-4 |
| 15 | g9756.t1 | SUPERFAMILY | SSF81321 | Family A G protein-coupled receptor-like | 13 | 342 | 7.05E-78 |
| 39 | g9756.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 44 | 66 | - |
| 38 | g9756.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 78 | 100 | - |
| 34 | g9756.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 115 | 137 | - |
| 36 | g9756.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 158 | 180 | - |
| 33 | g9756.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 214 | 236 | - |
| 37 | g9756.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 257 | 279 | - |
| 35 | g9756.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 294 | 316 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0007186 | G protein-coupled receptor signaling pathway | BP |
| GO:0016021 | integral component of membrane | CC |
| GO:0004930 | G protein-coupled receptor activity | MF |
KEGG
Orthology
- This transcript has been annotated with K04231 (galanin receptor 2)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed