Gene loci information

Transcript annotation

  • This transcript has been annotated as Allatostatin-A receptor.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g9758 g9758.t1 isoform g9758.t1 5050081 5057908
chr_1 g9758 g9758.t1 exon g9758.t1.exon1 5050081 5050121
chr_1 g9758 g9758.t1 cds g9758.t1.CDS1 5050081 5050121
chr_1 g9758 g9758.t1 exon g9758.t1.exon2 5050782 5050863
chr_1 g9758 g9758.t1 cds g9758.t1.CDS2 5050782 5050863
chr_1 g9758 g9758.t1 exon g9758.t1.exon3 5053258 5053413
chr_1 g9758 g9758.t1 cds g9758.t1.CDS3 5053258 5053413
chr_1 g9758 g9758.t1 exon g9758.t1.exon4 5054665 5054859
chr_1 g9758 g9758.t1 cds g9758.t1.CDS4 5054665 5054859
chr_1 g9758 g9758.t1 exon g9758.t1.exon5 5055087 5055234
chr_1 g9758 g9758.t1 cds g9758.t1.CDS5 5055087 5055234
chr_1 g9758 g9758.t1 exon g9758.t1.exon6 5055325 5055455
chr_1 g9758 g9758.t1 cds g9758.t1.CDS6 5055325 5055455
chr_1 g9758 g9758.t1 exon g9758.t1.exon7 5056761 5056788
chr_1 g9758 g9758.t1 cds g9758.t1.CDS7 5056761 5056788
chr_1 g9758 g9758.t1 exon g9758.t1.exon8 5056891 5056930
chr_1 g9758 g9758.t1 cds g9758.t1.CDS8 5056891 5056930
chr_1 g9758 g9758.t1 exon g9758.t1.exon9 5057081 5057121
chr_1 g9758 g9758.t1 cds g9758.t1.CDS9 5057081 5057121
chr_1 g9758 g9758.t1 exon g9758.t1.exon10 5057195 5057240
chr_1 g9758 g9758.t1 cds g9758.t1.CDS10 5057195 5057240
chr_1 g9758 g9758.t1 exon g9758.t1.exon11 5057746 5057908
chr_1 g9758 g9758.t1 cds g9758.t1.CDS11 5057746 5057908
chr_1 g9758 g9758.t1 TSS g9758.t1 NA NA
chr_1 g9758 g9758.t1 TTS g9758.t1 NA NA

Sequences

>g9758.t1 Gene=g9758 Length=1071
ATGTTTGGAGAAGTGTGCAATAATTACACGCATACCTTTTTATGGGGCAACGAGACAATC
CAATTTGACCATGAACTCGAATGCACTGTCTCTAAAACGGTCTTCATACTCTTCACATTT
ATTGGAATTGCTGGTCTCGTTGGAAATGCACTCGTGGTGCTCGTTGTTGCCGCAAATCCC
ATGATGAGATCGACGACTAACATTCTAATAATAAACTTGGCCGTTGCCGATCTGCTATTT
GTGATATTTTGCGTTCCTTTCACTGGTTTCGATTATGTCCTTGCAAGCTGGCCATTTGGG
ACGACGTGGTGTTCAACTGTTCAGTATATGATAGTAGTGACATGCCATGCAAGTGTATAT
ACACTTGTTCTGATGTCACTTGACCGATTTCTGGCTGTCGTTCATCCAATTTCTAGCATT
TCAATACGAACGCAACGAAATGCGTTATTTGCGATCATAATAACATGGCTAATTGTCACA
ACAACTGCCTTTCCCGTTTTTATGTCTCACGGCGAAGTGCAATATTACAATCATCGAAAT
GAAGTGAACACAGCATGTTTATTTTTAAACGATGTCTATAACCTAGCAGCCTTTCAAATC
TCGTTTTTCCTCTCGTCCTATGTAATACCATTAGCGCTTATTTCAATTTTATATGTTGGT
ATGCTAATACGACTCTGGCATAGTGTGCCGGGAAGTAAAGTGTCAGCAGAATCGAGACGC
GGAAAAAAACGTGTAACACGGATGGTTGTGTTTGTCGTATTAGCCTTTGCCATATGTTGG
TTGCCTATTCATATTGTTCTTGTATTAAAGTCATTACATATGTATGAAACAAGTCGTTTA
GGCGTATCCATACAAATTTTTAGTCATGTACTTGCGTACACAAATAGTTTTATAAATCCA
ATCTTGTACAATTGCTTCTCTAAAAACTTTCGAAAGGCCTTTAGAAAAATAGTCTGGTGC
GGAAAGCCAATACCTCTGGGAACTACAAATGCTCAGATCACGAAAGCCGGAACAACAAGA
ACAACTACAGCCGCCCAAAACGGGGGAATTTCACCCCCCGAATTCCTCTAA

>g9758.t1 Gene=g9758 Length=356
MFGEVCNNYTHTFLWGNETIQFDHELECTVSKTVFILFTFIGIAGLVGNALVVLVVAANP
MMRSTTNILIINLAVADLLFVIFCVPFTGFDYVLASWPFGTTWCSTVQYMIVVTCHASVY
TLVLMSLDRFLAVVHPISSISIRTQRNALFAIIITWLIVTTTAFPVFMSHGEVQYYNHRN
EVNTACLFLNDVYNLAAFQISFFLSSYVIPLALISILYVGMLIRLWHSVPGSKVSAESRR
GKKRVTRMVVFVVLAFAICWLPIHIVLVLKSLHMYETSRLGVSIQIFSHVLAYTNSFINP
ILYNCFSKNFRKAFRKIVWCGKPIPLGTTNAQITKAGTTRTTTAAQNGGISPPEFL

Protein features from InterProScan

Transcript Database ID Name Start End E.value
32 g9758.t1 CDD cd15096 7tmA_AstA_R_insect 33 314 1.90774E-126
16 g9758.t1 Gene3D G3DSA:1.20.1070.10 - 6 346 4.0E-84
2 g9758.t1 PANTHER PTHR24243 G-PROTEIN COUPLED RECEPTOR 22 342 1.4E-70
7 g9758.t1 PRINTS PR00237 Rhodopsin-like GPCR superfamily signature 33 57 1.1E-48
6 g9758.t1 PRINTS PR00237 Rhodopsin-like GPCR superfamily signature 66 87 1.1E-48
12 g9758.t1 PRINTS PR00663 Galanin receptor signature 80 94 4.8E-12
14 g9758.t1 PRINTS PR00663 Galanin receptor signature 97 115 4.8E-12
4 g9758.t1 PRINTS PR00237 Rhodopsin-like GPCR superfamily signature 111 133 1.1E-48
11 g9758.t1 PRINTS PR00663 Galanin receptor signature 139 155 4.8E-12
8 g9758.t1 PRINTS PR00237 Rhodopsin-like GPCR superfamily signature 147 168 1.1E-48
10 g9758.t1 PRINTS PR00663 Galanin receptor signature 194 209 4.8E-12
5 g9758.t1 PRINTS PR00237 Rhodopsin-like GPCR superfamily signature 199 222 1.1E-48
3 g9758.t1 PRINTS PR00237 Rhodopsin-like GPCR superfamily signature 245 269 1.1E-48
13 g9758.t1 PRINTS PR00663 Galanin receptor signature 272 292 4.8E-12
9 g9758.t1 PRINTS PR00237 Rhodopsin-like GPCR superfamily signature 285 311 1.1E-48
1 g9758.t1 Pfam PF00001 7 transmembrane receptor (rhodopsin family) 48 303 1.8E-56
22 g9758.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 1 33 -
30 g9758.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 34 57 -
20 g9758.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 58 68 -
27 g9758.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 69 89 -
24 g9758.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 90 108 -
26 g9758.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 109 127 -
19 g9758.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 128 147 -
31 g9758.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 148 168 -
23 g9758.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 169 206 -
29 g9758.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 207 227 -
17 g9758.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 228 247 -
25 g9758.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 248 266 -
21 g9758.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 267 285 -
28 g9758.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 286 306 -
18 g9758.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 307 356 -
41 g9758.t1 ProSitePatterns PS00237 G-protein coupled receptors family 1 signature. 117 133 -
42 g9758.t1 ProSiteProfiles PS50262 G-protein coupled receptors family 1 profile. 48 303 49.58
40 g9758.t1 SMART SM01381 7TM_GPCR_Srsx_2 42 318 3.9E-5
15 g9758.t1 SUPERFAMILY SSF81321 Family A G protein-coupled receptor-like 20 326 1.28E-73
39 g9758.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 34 56 -
35 g9758.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 68 90 -
34 g9758.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 105 127 -
36 g9758.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 147 169 -
33 g9758.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 197 219 -
38 g9758.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 249 269 -
37 g9758.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 284 306 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0007186 G protein-coupled receptor signaling pathway BP
GO:0016021 integral component of membrane CC
GO:0004930 G protein-coupled receptor activity MF

KEGG

Orthology

Pathway

This gene does not belong to any pathways.

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed